KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1687Help
Entry
Lacal_1687        CDS       T01533                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00010  Glycolysis / Gluconeogenesis
lan00020  Citrate cycle (TCA cycle)
lan00620  Pyruvate metabolism
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01130  Biosynthesis of antibiotics
lan01200  Carbon metabolism
Module
lan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lacal_1687
   00020 Citrate cycle (TCA cycle)
    Lacal_1687
   00620 Pyruvate metabolism
    Lacal_1687
Enzymes [BR:lan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lacal_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 RP-C_C CPSF100_C
Motif
Other DBs
NCBI-ProteinID: AEH01535
UniProt: F6GCY5
Position
1921167..1922831
Genome map
AA seq 554 aa AA seqDB search
MAEIINMPRLSDTMEEGTVASWLKNVGDKIEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGETAKVDSLLAIIGEEGEDISGLLNGDSQDDKTNESSSEKTEDTSNKTSKEESQDTN
EETNTETQDLPEGVTVVTMPRLSDTMEEGTVATWLKNVGDEVEEGDILAEIETDKATMEF
ESFQSGNLLHIGLQEGESAKVDALLAIIGPAGTDVSSIAKNFKVGGSDSAPKEKKVEAPK
QTKKEDAPKAAAKTEAPKKEVSTSNNNSSSQRIFVSPLAKKMADEKGIQLNQVKGSGENG
RIVKRDIENFTTSVASSASAAKFVPTGQEDFDEKSNSQMRKVIAKRLGESKFTAPHYYLN
VEFDMENAIAFRAQYNSLPDVKISYNDMIIKACALALRQHPQVNSQWFSDKIRTNNHVHI
GVAVAVDEGLVVPVVKFANEQSLPQIGGEVRDYAKRARAKKLTPAEMEGSTFTISNLGMF
GIESFTSIINQPNSAILSVGAIVAKPVVKNGQVVAGNTMKLTLACDHRTVDGATGAQFLQ
TLKGFVENPVTMLV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattattaacatgccgcgattaagcgacacgatggaagaaggtactgtagct
tcttggttaaaaaatgtaggagataaaattgaagaaggagacattttagccgaaattgaa
acagataaagcaacaatggagtttgagtcttttaacgaaggtactttgcttcatattgga
attcaagaaggagaaactgcaaaagtagattcgcttttagctataattggtgaagaaggt
gaagatatttcaggtttgcttaatggcgattctcaagatgataaaacaaatgagtcttct
tctgaaaaaactgaagatacctcaaataaaacgtctaaagaagaaagccaagatactaac
gaagaaacaaatacagaaacccaagatttaccagaaggtgtaaccgtagtaacaatgcca
cgtttaagtgatactatggaagaaggaactgttgcaacgtggctaaaaaatgttggtgat
gaagttgaagaaggagatattttagccgaaattgaaacagataaagctacaatggagttt
gaatctttccaatcaggtaatttattacatataggattacaagaaggagaatcagccaaa
gtagatgctttgttagctataattggtcctgcaggaacagacgtatcgtcaattgctaaa
aactttaaagttggaggtagtgatagtgcacctaaagagaaaaaagtagaagcaccaaaa
caaacaaaaaaagaagatgctcctaaagctgcagctaaaactgaagcacctaaaaaggag
gtatcaacgtcaaacaataattctagttcacaaagaatttttgtatctccattagctaaa
aagatggcagacgaaaaaggcatacaacttaaccaagtaaaaggttctggtgaaaacgga
agaattgtaaaacgtgatatagaaaactttacaacatctgtagcatcttctgcatcagca
gctaagtttgtgccaacaggacaagaagattttgatgagaaatctaactcgcaaatgcgt
aaagttattgctaaacgtttaggagaatctaaatttacagcaccgcattactatttaaat
gtggagtttgatatggaaaatgccattgcctttagagcacagtataattcattaccagat
gtaaaaatatcttataatgatatgattattaaagcgtgtgcgctagcattacgccaacat
ccacaagttaactcacaatggtttagtgataaaattagaacaaataatcacgtacacatt
ggtgttgctgttgcagtagacgaaggtttagtagtaccagttgtaaaatttgctaatgag
caaagtttacctcaaattggaggagaagttagagattatgcaaaacgtgcaagagcaaaa
aaattaactccagccgaaatggaaggtagcacatttactatttcaaacttaggtatgttt
ggtatagaaagctttacatctattataaatcaaccaaactcagcgatactttcagttgga
gctatagttgcaaagccagtagttaaaaacggtcaagttgtagcaggtaatacaatgaaa
cttactctagcatgcgatcatagaacagtagatggagctacaggagctcagtttttgcaa
accctaaaaggttttgtagaaaatccagtaactatgttagtgtaa

DBGET integrated database retrieval system