KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1734Help
Entry
Lacal_1734        CDS       T01533                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00260  Glycine, serine and threonine metabolism
lan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01130  Biosynthesis of antibiotics
lan01230  Biosynthesis of amino acids
Module
lan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lacal_1734
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lacal_1734
Enzymes [BR:lan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lacal_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH01582
UniProt: F6GDH8
Position
complement(1964630..1965811)
Genome map
AA seq 393 aa AA seqDB search
MTYNIDDKGYYGEFGGAYIPEMLYPNVEELRQNYLKVMAEPLFKKEFDQLLKDYVGRPSP
LYFAKRLSDKYKTKIYLKREDLNHTGAHKVNNTIGQILMAQRLGKKRIIAETGAGQHGVA
TATVCALMGLECIVYMGEIDIARQAPNVARMKMLGATVIPATSGSKTLKDATNEAIRDWI
NNPVDTHYIIGSVVGPHPYPDMVARFQAVVSEEIQWQLKEKEGKTTPNYVIACVGGGSNA
AGSYYHYLEDTNVNLIAVEAAGKGVHSGESAATSALGKEGIIHGSKTLLMQTNDGQIIEP
YSISAGLDYPGVGPMHAHLYKSGRAEFISVTDNEAMTSGLELCKLEGIIPAIESSHAFAV
LNKKTFKEDDIVVINLSGRGDKDLQNYIDYFKI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacctataatattgacgacaaaggatattacggtgaatttggtggtgcatacattcca
gaaatgctttatcctaacgttgaagagttacgccaaaactacctaaaagtaatggcagaa
ccattatttaaaaaggaatttgatcaattactaaaagattacgttgggcgtccatcacca
ttgtattttgcaaaaagattaagcgataaatacaaaactaaaatctatttaaaacgagaa
gatttaaaccacactggtgcacataaagtaaacaatacaatcggacagattttaatggcg
caacgtttaggtaaaaaacgcataattgcagaaactggagcaggacagcatggtgttgca
actgccactgtttgcgcgcttatgggcttagagtgtattgtttacatgggagaaatagat
attgcacgtcaagctccaaatgttgcaagaatgaaaatgttaggtgcaacagtaatacct
gctacttcaggaagtaaaacattaaaggacgcaacaaacgaagcgataagagattggatt
aataatcctgtagatacacattatattattggtagcgttgttggtccgcacccatatcca
gatatggttgctcgttttcaagcagtagtatcagaagagatacaatggcaattaaaagaa
aaagaaggcaaaacaacaccaaattatgttattgcttgtgttggtggcggtagtaacgct
gctggatcatactatcattatttagaagatactaatgtaaatttaatagctgttgaagct
gctggtaaaggtgtacattctggtgaaagcgctgcaacttcagcacttggtaaagaaggt
attattcacggtagtaaaacattgttaatgcaaaccaatgacgggcaaattatcgagcca
tattcaatctcagcaggattagattatcctggtgttggaccaatgcatgcgcatttatat
aaatctggaagagcagaatttatctcggtcacagataatgaagctatgacatctggctta
gaattatgcaaattagaaggtattattcctgccatagaaagctctcatgcctttgccgtt
ttaaataaaaaaacatttaaagaggacgatattgtagtaattaatttatctggacgtggt
gacaaagacttacaaaactacatagactattttaaaatttaa

DBGET integrated database retrieval system