KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2259
Entry
Lacal_2259        CDS       T01533                                 

Definition
(GenBank) hypothetical protein
Organism
lan  Lacinutrix sp. 5H-3-7-4
SSDB
Motif
Pfam: TssD
Other DBs
NCBI-ProteinID: AEH02102
UniProt: F6GGQ2
Position
complement(2524918..2525316)
AA seq 132 aa
MSFLAKLTIDDQEFNVLSFSFDVNQQVNHGSARPTGLAIINHIHISIESAENSGFFGWSV
NSYEQKDGEIVFYKRDAMASSRTLKFTGAFCVNYNEVFQSNSANPMITNLVLTVETLELD
DTLYINPSIKNL
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcttttttagcaaaattaaccatagatgatcaagaatttaatgtcttatcattttct
tttgatgttaaccaacaagttaaccatggctctgcaagacctacaggtttagcaataata
aatcatattcacatatctatagaatctgcagaaaattctggtttttttggctggagtgtt
aatagttacgagcaaaaagatggtgaaattgtgttttataaaagagacgctatggcaagc
tccagaaccttaaagtttactggtgctttttgtgttaattataatgaagtatttcaaagt
aacagtgcaaacccaatgattactaatttagttctaactgtagaaacattagaattagac
gatactttatatataaacccatctataaaaaatttataa

DBGET integrated database retrieval system