KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2270
Entry
Lacal_2270        CDS       T01533                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Lacal_2270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lan02044]
    Lacal_2270
Secretion system [BR:lan02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Lacal_2270
SSDB
Motif
Pfam: Phage_base_V Phage_GPD DUF2345
Other DBs
NCBI-ProteinID: AEH02113
UniProt: F6GGR3
Position
complement(2534428..2536233)
AA seq 601 aa
MAILSTTNININGNKLPYYNSCNLEQEIGKHHTMHLHCLIETIETFCADNNIEIDDLLGA
PITIETSSFAKMDFLGALKFKGLITAINFQKGLYNNEGDYIEFNIQSPTILSDDGSHYTS
YSEMSFVEIIKKNFNDYDASKLSVNTKNATLNSPLLYTVQSNESCFEFAQRLAAKYGEWM
FFNGEELVFGLPSSNKEIELKFGRDLNSFTTQLAPKPQNFNYFSSNYIENITHEKKSAKN
GSTNNGYFNVVNRNSKDLFSKKTTIWANIQNDTTSKTQLDSAVEKHQKAIESNQIKIYAS
CDNPGIKLTSVVKILNNLYRVVKVTHDYKSNGEYNNTFEAVSINVEAYPYTNITAIAKSP
SQMATVIDNVDPENLGRIKVQFPWQKENGLTTPWIRIVSPHAGKDKGFHFIPEKDEEVLI
GFEGDYAEKPYVLGSLYHSQAKPDSWKTNSNNIKAIRTRSGHTIELNDTGGTESITITDI
NKNLINIDTANNNITITALENMTLNSKNMQINVQENLDLNVGNTKTEIIQKDKTEKITGN
HNINSNNSTEQVANNKTLTAGSNYNQSSANAKMLATKGDLTIHASGVSTFQGSADVKISK
G
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggctattttatctactacaaatattaatattaacggtaataaacttccttactataac
agttgtaatttagagcaggaaattggtaaacatcatacaatgcatttgcattgtttaata
gaaacaattgaaacattttgtgcagataataatatagaaatagacgatttattaggcgca
ccaattaccatagaaaccagttcttttgctaaaatggactttttaggagccttaaaattt
aaaggcttaattacagctataaatttccaaaaaggtttatataataatgagggcgattat
atagagtttaatatacaaagtccaacaatcctgtcagacgacggttcgcactatacctct
tatagcgagatgagttttgtagaaattattaaaaaaaattttaatgactacgatgcttca
aaactttctgtaaacacaaaaaatgctactttaaactcaccactactctacactgttcag
tctaacgaaagttgttttgaatttgcacaacgtttagctgctaaatatggcgaatggatg
ttttttaatggcgaagaacttgtttttggtttaccgtccagcaataaagaaatagagctt
aagtttggtagagacttaaatagttttacaactcaattagcaccaaaaccacaaaatttt
aattatttttctagtaattatatagagaatattacacacgaaaaaaagtctgctaaaaat
ggatcaactaataatggctattttaatgtagttaatagaaactctaaagatcttttttca
aaaaaaacaactatttgggctaacattcaaaatgatacaacaagcaaaacccaattagac
tctgctgtagaaaaacatcaaaaagctatagaaagtaatcaaataaaaatatatgcctct
tgtgataatcctggtataaaactaacatctgtagttaaaattctgaataatttatatcga
gtagtcaaagttacacacgattataaaagcaatggagaatataataatacgtttgaagcc
gtctcaataaatgtagaagcatacccatatactaacataactgcaatagctaaaagtccc
tcacaaatggctactgttatagataatgtagatccagaaaatttaggccgaattaaagtg
cagtttccatggcaaaaagaaaacggactaacaacgccttggattcgtatagtaagtccg
catgcaggaaaagataaagggtttcattttataccagaaaaagacgaagaagttttaatt
ggttttgaaggtgattatgccgaaaaaccttatgtacttggcagcttgtatcacagtcaa
gcaaagccagatagctggaaaacaaattctaataatataaaagctattagaacacgatct
ggacataccattgaactaaacgatacaggtggtacagaaagtattacaattacagacata
aacaaaaacctaattaatattgatactgctaataacaatattacaattacagctttagaa
aacatgacattaaactctaaaaatatgcaaataaacgtgcaggaaaacttagatttaaat
gttggtaacactaaaacagagattatacaaaaagataaaaccgaaaagattacaggcaat
cacaatataaactctaacaatagtacagagcaagtagcaaacaataaaaccttaacggca
ggttcaaattacaaccaatcttcagctaatgctaaaatgttagccacaaaaggagattta
accatacatgcaagtggtgtttctacttttcaaggcagtgcagatgttaaaataagtaaa
ggctaa

DBGET integrated database retrieval system