KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2274
Entry
Lacal_2274        CDS       T01533                                 

Definition
(GenBank) gpW/GP25 family protein
Organism
lan  Lacinutrix sp. 5H-3-7-4
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEH02117
UniProt: F6GGR7
Position
2539072..2539506
AA seq 144 aa
MIKNYYELPLKPANFFTKKEHDTCDIKQSIAHYIHLINTSHFGECSFDETFGSSIWELDF
DNLKSSNKLKSIIKQSLEEAIKEHEKRLVNVIVEAKIKQEEILDNNTLNRIKKRVDLVIR
AKVKKTNETFKYVEYFYIGPLSYQ
NT seq 435 nt   +upstreamnt  +downstreamnt
atgattaaaaactattacgaattacctctaaaaccagctaatttttttactaaaaaagag
cacgatacttgtgatattaaacaatcgatagcacattatattcacttaataaatacatct
cattttggagaatgtagttttgatgaaacttttggaagctctatttgggaattagatttc
gataatttaaagagttctaataaattaaaatctataattaagcagtctctagaagaggct
ataaaagaacacgaaaaaagattagttaatgttattgtagaggctaaaattaagcaagaa
gaaattttagataataacacattaaatagaataaaaaaaagagtagatctggtaattagg
gcaaaagttaaaaaaaccaacgagacttttaaatatgttgagtacttttacataggtcca
ttatcttaccaataa

DBGET integrated database retrieval system