KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2276
Entry
Lacal_2276        CDS       T01533                                 

Definition
(GenBank) PKD domain containing protein
Organism
lan  Lacinutrix sp. 5H-3-7-4
SSDB
Motif
Pfam: PKD_4 PKD PapC_N
Other DBs
NCBI-ProteinID: AEH02119
UniProt: F6GGR9
Position
2541387..2542382
AA seq 331 aa
MSKYNNSSSHIDKTVIYVFLFVFFASISVFAYRYTKYSPCENVTFNIDKAQNTVGELIKF
KDVTDTAESWYWDFGDNSIASTQKEPLHVYKTPGDYTVKLIVNDICEATQTVSIAEKKEV
LDPTKFPIFELQKTIKVGQKLRVNDETENASTWEWRFGETAKINANTKRASYVYTEPGLK
TVSLVVNGDLKYVTKKTIEVLPLAETKRKPIDIPQAPSKPSVDIKYKPESAIKDKPSTPK
LAPYISEADFKAKMMKVSKEEMSAKQFSEYFCGDINKKIVANGRNTTFLVFCEKISDKKI
RIKKLEIFRDKGSNCINTITIDCRIRGLFND
NT seq 996 nt   +upstreamnt  +downstreamnt
atgagcaagtataataattcatcaagccatatcgataaaactgtaatttatgtttttttg
tttgttttttttgcatccataagtgtatttgcttatagatatactaaatattcaccttgt
gaaaatgtaacctttaatatcgataaagcccaaaacacagttggagaactaataaaattt
aaggatgttacagacacggcagaatcatggtattgggattttggtgataactccatagca
tcaacacaaaaagaaccattacacgtttacaaaacaccaggagattacacagtaaaacta
atagttaatgatatttgtgaagcaacacaaaccgtttctatagcagagaaaaaagaagtt
ttagacccaacaaagtttccaatattcgaacttcaaaaaactataaaagtaggtcaaaaa
ctaagagtaaatgacgaaacagaaaacgcatcaacctgggagtggcgttttggagaaaca
gcaaaaataaacgcaaatacaaaacgtgcaagttatgtatatacagagccagggttaaaa
acagtatctttagtagtaaatggagatttaaaatacgtaactaaaaaaacaatcgaagtt
ttaccactagcagaaacaaaaagaaaacctatagatataccacaagcaccatctaaacca
agtgtagatattaagtacaaaccagaatctgcaattaaagataaaccatctacaccaaaa
ttagccccatatataagcgaagcagattttaaagcaaaaatgatgaaagtctctaaagaa
gaaatgagtgcaaaacaattttcagaatatttttgtggagatattaataaaaaaatagtt
gctaatggaagaaatacaacatttctagtattctgcgaaaaaataagcgacaaaaaaata
agaatcaaaaagttagaaatttttagagataaaggatcaaattgtataaatactattaca
atagattgtagaatacgagggctttttaacgactag

DBGET integrated database retrieval system