KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2382Help
Entry
Lacal_2382        CDS       T01533                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00220  Arginine biosynthesis
lan00250  Alanine, aspartate and glutamate metabolism
lan00471  D-Glutamine and D-glutamate metabolism
lan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lacal_2382
   00220 Arginine biosynthesis
    Lacal_2382
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Lacal_2382
Enzymes [BR:lan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Lacal_2382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase RST
Motif
Other DBs
NCBI-ProteinID: AEH02224
UniProt: F6GHN8
Position
complement(2650638..2651552)
Genome map
AA seq 304 aa AA seqDB search
MIDFQEVINEIYSDLKTTKDKGTVASYIPELEKQSASSFGIYLKHLGGKDYHAGDWDVAF
SIQSISKVLALSKAITFENKNLWQRVDVEPSGNPFNHLSLLEQENGIPRNPLINAGAIVI
ADILVTHLKNPKEDFLNYVREITGDQTIDFNLKVVASEKRTGFNNYAAANLLKAYNNLDN
DVEEVLDFYFHQCAIEMSCKQLANAFYLFTHRGECINKTKHLTLNQVKRINAIMLTCGFY
DEAGEFAFEVGLPGKSGVGGGIVALLPNDFVIVTWAPGLNEKGNSLIGMQALEQFTTKTK
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttcaagaagttataaatgagatttatagtgatttaaaaaccactaaagat
aaaggtactgtagcttcttacattccagagctagaaaaacaaagtgcttctagttttggt
atatacttaaaacatttaggcggtaaagattaccatgcaggagattgggatgtagcattt
tctatacaaagtatttcgaaagtattagctttatctaaagctattactttcgaaaataaa
aacctatggcaacgtgtagatgtggaaccatctggaaacccatttaatcacttatcactt
ttagaacaggaaaacggcatacctagaaacccacttataaatgctggtgctattgttatt
gcagatattttagtaacacatttaaaaaatcctaaagaagactttttaaattatgttaga
gaaattactggagatcaaactatagattttaatttaaaagttgtcgcgtctgagaagcgt
actggttttaataactatgcagctgcaaatcttttaaaagcatacaataatctcgacaat
gatgtagaagaggttttagacttttactttcaccaatgcgcaatagaaatgagttgcaag
caattggctaatgctttctatttatttactcacagaggagaatgtataaataaaacaaag
caccttacattaaatcaagtaaaacgtattaatgcaattatgcttacctgcggtttttat
gacgaagctggagaatttgctttcgaggttggtttacctgggaaaagtggtgttggtggc
ggtattgttgctcttttacctaatgattttgtaattgttacttgggctccaggattaaat
gaaaaaggaaattctttaataggaatgcaagctttagagcaatttactacaaaaacaaaa
cgttctattttttaa

DBGET integrated database retrieval system