KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2615Help
Entry
Lacal_2615        CDS       T01533                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00260  Glycine, serine and threonine metabolism
lan00750  Vitamin B6 metabolism
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01230  Biosynthesis of amino acids
Module
lan_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lacal_2615
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lacal_2615
Enzymes [BR:lan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lacal_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEH02456
UniProt: F6GJL1
Position
2913097..2914392
Genome map
AA seq 431 aa AA seqDB search
MKYYSLNHKAENTSFKNAVVKGLAPDKGLYFPENITPLPKSFFDNIQNLSNTEIAFQAIK
QFVTPDIPEQVLKTIIEETLSFNFPIVNLSEHISTLELFHGPTMAFKDVGARFMARCLGY
FNKENSNEVTVLVATSGDTGGAVANGFLGVKGVNVVILYPSGKVSDIQEKQLTTLGNNIT
ALEVDGVFDDCQDMVKRAFLDEDLTSKMQLTSANSINVARWLPQLFYFMFAYKQLHKKHE
NIVFSVPSGNFGNVCAGMMAQQLGLPIKHFIASNNENNVVTNYLHTKEYKPKPSVQTISN
AMDVGNPSNFIRIKEIYKNNFDSLKTNLSSYSFNDIETKKALKEIFDNYNYVADPHGAVG
YLGCKAYLKDNKNSHCVFLETAHPTKFLDVVEEVIKEKQLLPKQIQAVIDKEKVSTQIST
YNELKQFLLNK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattactcactaaaccataaagctgaaaatacaagttttaaaaatgctgttgtt
aaaggtttagcaccagataaaggattgtactttcctgaaaacataacacctttaccaaaa
tcttttttcgataacattcaaaatctaagtaataccgagattgcttttcaagctataaaa
caatttgtaacaccagatattcctgagcaggttttaaaaacaattatagaagaaacgcta
tcttttaattttcctattgtaaatttaagtgagcatatttctacattagagttatttcat
ggaccaacaatggcttttaaagatgttggagctagatttatggcaagatgcttaggctat
tttaataaagaaaacagtaacgaagtcacagtattagtagctacttctggagatactgga
ggcgcagtggcaaacgggtttttgggtgtaaagggagtaaatgttgttatattatatcct
agcggaaaagtaagtgatatacaagaaaaacaattaacaacgttaggaaacaatattaca
gctttagaagttgatggtgtttttgatgattgccaagatatggttaagcgtgcattttta
gacgaagatttaacaagtaaaatgcaattaacctctgcaaattcaattaatgttgcgcgt
tggttaccacaacttttctattttatgtttgcatacaaacaattacataaaaaacatgaa
aacattgtattctcggtacctagcggtaattttggaaatgtttgcgctggtatgatggca
cagcaattagggctaccaattaaacattttatagcttctaataatgaaaacaatgttgtt
actaattacttacatacaaaggagtacaaaccaaaaccatctgtacaaactattagtaat
gcaatggatgttggtaatccaagtaattttataagaattaaagaaatttataaaaataat
ttcgatagtttaaaaacaaacttatcctcatatagttttaatgatattgaaactaaaaag
gctttaaaagaaatttttgataactataattatgtagcagatccacatggcgctgttgga
tatttgggctgtaaagcatatttaaaagataataaaaatagccattgtgtgtttttagaa
acagcacacccaactaagtttttagatgttgtagaagaagttattaaagaaaaacaacta
ttaccaaagcaaattcaagcggttatagataaagaaaaagtttcaacccaaataagtact
tataatgagttgaaacagtttcttttaaataagtaa

DBGET integrated database retrieval system