KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109329938Help
Entry
109329938         CDS       T04664                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lang01001]
    109329938
   01009 Protein phosphatases and associated proteins [BR:lang01009]
    109329938
Enzymes [BR:lang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109329938
Protein kinases [BR:lang01001]
 Serine/threonine kinases: Other
  Wnk family
   109329938
Protein phosphatases and associated proteins [BR:lang01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109329938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109329938
NCBI-ProteinID: XP_019419395
Position
LG16
AA seq 625 aa AA seqDB search
MNSVIEVEEDYSSEFVEVDPSGRYGRYNEILGKGAFKTVYRAFDEYQGIEVAWNQVKLYD
FLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTSNRNINFVTEMFTSGTLRQYRLKH
KRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILR
KSQADHCVGTPEFMAPEVYEEAYNELVDIYSFGMCVLEMVTFEYPYSECNHPAQIYKKVI
SGKKPDSLYKVKDTEVREFIEKCLATVSLRLSARELLDDPFLRSDDYEYDFGPVNGRAWD
HSPLTSHHLFDLHQSYNNISAEYSNGFSFEGEWCNTPAEIEASGIELFECHDDEESSEDV
DISIKGKRHDDNGGIFLRLRIADKDSRIRNIYFPFDVEMDTAMCVASEMVAELDITDQDV
TRIADMIDGEIASLVPKWRSGSGIEETPKSANHGFCQNCVSNHTSNGSLMDFLSHDQDGK
NIQFLQCHGCASMHGRFEEITFQSNEYDKHDGEDAPNVSTKSQCLQYLELWNQHESHEPN
PIESNRSHSDQHLDKSVSEDDRGQDVWENKLAPDAQNTLRDLPGTRYFPTIRSLYCGLED
GYEKENTTRTEMMAKSKIQNGVKGT
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgtgatagaggttgaagaagattatagttctgagtttgtggaagttgatcca
agtggaagatatggcagatacaatgaaatcctaggaaagggtgctttcaaaacagtatat
agagcatttgatgagtatcaagggattgaagttgcatggaaccaagttaaactctatgat
tttcttcaaagccctgaagatcttgagagactatactgtgaaattcatcttttgaaaaca
ttgaaacatagaaatattatgaaattttacacatcttgggtggatacttctaatagaaat
atcaactttgttactgaaatgttcacttctggtactcttagacagtatcggctaaagcat
aagcgagttaacatcagagctgtgaagcattggtgtagacagatcttaagaggacttctt
tatcttcatagtcatgatccccctgtaattcatagagatctcaaatgtgataatattttt
gtcaatggaaatcaaggagaagttaagattggtgatcttggccttgcagcaattctacga
aaatctcaggccgatcattgtgtaggaacgcccgagttcatggccccagaagtatatgaa
gaggcatataatgaactagttgacatatattccttcgggatgtgtgtattggaaatggtt
acatttgaatatccttatagtgaatgtaaccatccagcacaaatatacaagaaagttatt
tctggtaaaaaaccggattctttgtataaagtgaaggatacggaagtgcgagaatttatt
gagaaatgcttagcaaccgtgtctcttaggctctctgcaagggagcttctagatgatcct
tttcttcgaagtgacgattacgaatatgatttcgggccagtaaatggcagagcatgggat
cacagtcctctaacaagtcaccacctctttgatcttcatcagagctataataacatcagt
gccgaatactcaaatggttttagttttgaaggagaatggtgtaatactccagccgagatt
gaagctagtggaatcgaacttttcgagtgccatgatgatgaagaatcctctgaagatgtt
gacataagcatcaaaggcaagaggcacgatgataatggtggcatctttttgagactaaga
atcgcggataaagacagccgtatacggaatatttatttcccatttgatgtagagatggac
acagcaatgtgtgtagcatctgaaatggttgcggaactcgacattaccgatcaggatgtt
accagaatagcggatatgatagatggtgaaattgcttccttggttcccaaatggaggtcg
ggatcaggaatcgaggaaactcccaagtctgcaaatcatggtttctgtcagaattgtgtg
tctaatcatacttccaatggctctcttatggattttctttcacacgatcaagacggaaag
aacatacaatttcttcaatgccatggatgtgcttcaatgcatggacggtttgaggaaatt
accttccaatccaacgagtatgacaaacatgatggagaggatgcaccgaatgtttcaacc
aaatcacagtgcttgcagtacttggagttatggaatcagcacgaaagtcatgaaccgaat
ccaatagagtctaatcgaagccattctgatcagcatttagataaatcagtatcagaagat
gatcgaggacaggatgtttgggaaaacaagttagctcccgatgcgcaaaacaccttaaga
gatttaccaggaactcgctatttccctactatccgttccttatattgcggcctcgaggac
gggtacgagaaagagaatacaacaagaactgagatgatggctaagagcaaaatacaaaat
ggagttaagggtacttaa

DBGET integrated database retrieval system