KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109331258Help
Entry
109331258         CDS       T04664                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00760  Nicotinate and nicotinamide metabolism
lang01100  Metabolic pathways
Module
lang_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109331258
Enzymes [BR:lang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     109331258
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     109331258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 109331258
NCBI-ProteinID: XP_019421187
UniProt: A0A1J7G2S7
Position
LG17
AA seq 250 aa AA seqDB search
MDVPLPIDKLALHLITDQSSTSNTTTQGKIYVILVATGSFNPPTFMHLRMFELARDALNS
EGYCVIGGYMSPVNDAYKKKNLISAEHRIRLCQLACKSSEFVMVDPWEANQSTYQRTLTV
LSRVQSSICETGLVSRESLKVMLVCGSDLLQSFGIPGFWIRDQVKAISRDYGIVCISREG
QDVGIIISNDDILNENQANIKVVDELVPNQISSTRIRECIARGLSIKYLTADEVIDYIRE
QQLYAHSDDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggatgttcctttacccatagataaattagctttacacctcatcactgaccaatcctcc
acttcaaacaccacaacccaaggcaaaatatatgtaattctggtggcaactggaagcttc
aatccacctactttcatgcatttacgcatgtttgagcttgcaagagatgcgttgaattcg
gaagggtactgtgtaattggaggttacatgtcacctgtgaatgatgcatacaagaaaaag
aacctaatatctgctgagcatcgaatacgtttatgtcagctggcttgtaaaagttccgaa
tttgtaatggttgatccatgggaggcaaatcaaagcacgtatcagcgcactttaactgtt
ttgtccagagtccagagttcaatttgtgagactgggttggtatctagagaatcactcaag
gtcatgcttgtctgtggttccgatctgcttcaatcttttggcattcctggattctggatt
cgtgaccaggttaaggctatatctagagattatggaatagtatgcattagcagagaagga
caagatgttggtatcattatatctaatgatgacattttgaatgagaatcaggctaatatc
aaagttgtggatgaacttgtaccaaatcaaataagctcaacaagaataagggagtgcatt
gcaagaggattatcaataaaataccttactgcagatgaagtgattgattatatcagagag
cagcaattatacgcacactcagatgataaataa

DBGET integrated database retrieval system