KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109332680Help
Entry
109332680         CDS       T04664                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00130  Ubiquinone and other terpenoid-quinone biosynthesis
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    109332680
Enzymes [BR:lang01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     109332680
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     109332680
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     109332680
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     109332680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 MR_MLE_C Abhydrolase_1 Abhydrolase_6 Hydrolase_4 TPP_enzyme_C Abhydrolase_2 Thioesterase DUF900 Abhydrolase_3 Ndr BAAT_C DUF676 Esterase DUF2974 Lipase_3 DUF726
Motif
Other DBs
NCBI-GeneID: 109332680
NCBI-ProteinID: XP_019423240
Position
LG18
AA seq 1696 aa AA seqDB search
MISPMHAVPFQSLMLRNSATSFFLLPPPPPPPLAGARRFSPTVHVTGRGGVRFHGPLLLT
TDIDQNEVVFENCVTRNLPPALTLEEGLEKIKEALQLLKASPSPSSTGFLRFQVAVPPSP
KALSWFCCQPESSGVFPLIFVSKNMDNPTFKALHVNGSRGVFGIGTAVSFAHSSPGNQSL
IRRHISTDSTHIVAYGFMDINLDHELVSMTYEDHSFCFFIPQIELDEMETVSILIVTLAW
DDFSPSTFEEALHSLEVSLNQVISHICSTTDAQKSKCTTAALRKLNLVEDKSISRVYMNT
IAPGERESVGNIMELKESPSSSQFCVRLSATLTVSNNMLDHANKLLHSLNKSANINAVWA
SLIVEECSRLGLTYFCVAPGSRSSPLAVAASSHELITCISCFDERSLAFHAVGYARGSHI
PAVVITSSGTAVSNLLPAVVEASQDFVPLVLLTADRPPELLDCGANQAIDQVNHFGSFVR
FFFNLPPPSDQIPARMVLTTLDSAVHRATSSPCGPVHINCPFREPLESSPIGWMSSCLKG
LDFWRTNAEPFTKYIHMPLSQTCINGHGEIVEVLNLIQRANRGLLLYGAIHTEDEMWAAL
LLAKHLRWPVVADILSGLRLKKLSTSFPDIERNFIFVDNLDHALLSDSVKGWLEIDFVIQ
IGSKITSKRICQVLEECAPFSYIMVDKHPFRHDPSHIITHRIQTTIVDFVACLMKATVPR
TVCMWGTSLQLLSKMVDWEIQFQINAECSLTEPYVAHVISKSLSSESALFLGNSMPIRDA
DMYGHSWSICNRSVTSVMLNLDIPVNLIRVAANRGASGIDGLLSTAIGFAVGCNKKVSFV
IGDISLLHDTNGLAILKQRKLRKPMTIFVVNNHGGAIFSLLPLADKVEPNIMHQYFYTSH
NILIHGLCTAHGIKHLHVKTKAELEEALCVVQHEKMDCLVEIESSIEANSNFHSVLKKFA
LQTAQHTRRFLSVPFSRGSTGDELYLNRIRKVECLKYRIALSAPPTSASDYNNLKELYRE
GFILSIILADGSVGFGEVAPLEIHRENLVDAEYQLRFLIHVMEHVDIGGFLSLLKGSFSY
WIWNELGILPSSIFPSVRCGLEMAILNAIADAKGSNMLNILHPPINENDKCQSSLEAQIC
ALIDSNPSPTEVANVAATLVEEGFSAIKLKVARRGNPVQDAILIQEVRKKVGGQIIIRAD
ANRKWTYEEAMEFSSLVKDCNLQYIEEPVQNEDDILKFCEESGLPVALDETVDKIQENPL
EKLAKFTHPGIVAVVIKPSAIGGFENAALIAQWAHRLGKVAVVSAAFESSISLAAYTLFA
SYLELLSLSTFKVLDDRKVPSVAHGLGTYRWLKEDVAANPLLIGCSPHSGFVGASVADAS
RLLHDFQVNQNVISNIIAEKQVRRYQLKVEHNSFSCSFEVFETGQKTNDNVLVFLHGFLG
TGEDWITIMKTFSGSSRCISFDLPGHGKSVVDCAKDTGEEPLWSMEIIADVLQKLIHQIT
PAKVTLVGYSMGARIALYMALRFTSKTMGAVLISGSPGLKDKLSRKIRAAKDDSRARSVI
AHGLQPFLNSWYAGALWKSLRSHPHFNRIIASRMQHDGMQSLAKMLSGLSIGRQPSLWED
LPNCKVPLLIVHGEMDMKFKKIAEAMMKTLCSDLGSKHEEGNGIHEVFEVPKCGHAAHLE
NPLPIIDALRQFMTRL
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccaatgcatgcagtgccattccaatccctcatgctccgcaattctgcaacc
tctttctttctcctccctcctcctcctcctcctcctctcgccggagctcggagattctcg
ccgactgttcatgtcaccggaagaggaggagtgaggtttcacggtccactactcctaacc
accgacattgaccaaaacgaagtcgttttcgagaattgtgttacacggaatctacctccg
gcgttaacattggaggaaggtcttgagaagattaaggaagctcttcaattgttgaaggca
tcaccatctccttcctctactggatttcttaggtttcaggtggctgtcccgcctagtcca
aaggcgttgagttggttttgctgtcagccagagtcatcaggcgtgtttcccttgattttt
gtttctaagaacatggacaatccgacgtttaaggcacttcatgtgaacggaagccgtgga
gtttttggcattggtactgctgtttcttttgcacattcttcccccggaaaccagagtttg
ataaggagacacatctcaactgattcaacccatatagtggcttatggttttatggatatc
aacttagatcatgagttggtttccatgacttatgaggaccattctttttgctttttcatt
cctcagatcgagttagatgagatggagactgtttccattctgatagtgacacttgcatgg
gatgacttttccccctctacttttgaagaagctttgcattctcttgaagtttctctaaac
caggttatatctcatatctgctctaccactgatgcacagaaatccaaatgcactacagct
gcccttagaaaactcaatttggttgaagataaatctatttctcgggtctacatgaacact
attgcaccaggagaaagagaaagtgtgggtaacatcatggaactgaaagagtctccatct
tctagtcaattctgtgtcagactttcagcgacccttactgtttcaaataacatgttggat
catgccaataaattattgcactcactcaataaaagtgccaatatcaatgctgtttgggca
tcacttattgtagaagaatgctcaagacttggtttgacgtatttttgtgtagctcctgga
tccaggtcttccccacttgctgttgctgcttcaagtcatgagttaatcacttgtatttca
tgctttgacgagcgttcacttgcatttcatgctgttggatatgcaagaggatctcacatt
cctgcagtagtcataacatcatcaggcactgcagtttcaaaccttcttcctgctgttgtg
gaagctagtcaagattttgtaccacttgttttacttacagcagatcgacctccagagctg
ctggattgtggtgcaaaccaagctattgatcaggtgaatcattttggttcttttgtgaga
tttttcttcaatctccctccacccagtgatcagatccctgcaaggatggtacttactact
cttgattctgcagtacatcgagcaacttcttcaccatgtggtccagtgcatattaattgc
cctttcagagagcctttggaaagcagtcctattggatggatgtcaagctgcttaaagggg
ttagacttttggaggactaatgctgaaccatttaccaagtatattcatatgccattatct
cagacttgtataaatggtcatggagaaatagttgaagttttaaatctgattcaaagagcc
aaccgcggtcttctactatatggtgcaatccatacagaggatgagatgtgggctgctctt
cttttggctaaacacctccggtggcctgttgtggcagatatcttgtcagggctgcgtctg
aaaaagctttcaacttcttttcctgatattgaaagaaactttatatttgttgataatctg
gatcatgctctactctcagattctgttaagggctggttagagatcgattttgttattcag
ataggaagcaagataactagcaaacggatctgtcaagttcttgaggaatgtgctcccttt
tcatatattatggttgacaaacatccatttcgtcatgatccatcacacattataacccat
cggatacaaactaccattgttgattttgtggcttgtttaatgaaggctacagttccgcgg
acagtgtgcatgtggggcacttccctccagttgttgagtaaaatggttgattgggagata
caatttcaaattaatgctgaatgctccttaactgaaccttatgttgcacatgtgatatca
aaatctctttcctccgagtctgctctttttcttggtaacagcatgccaattcgtgatgca
gatatgtatgggcatagttggtccatatgcaacagaagtgttacatctgtcatgttaaat
ttagacataccagttaacttgataagggtggctgctaataggggggctagtggtattgat
ggtttgctcagcacagccattggttttgccgtaggatgcaacaaaaaggtgtcctttgtt
attggagatatttctttactgcatgatacaaatggtctggctattttgaagcagaggaaa
ctgcggaaaccaatgacgatttttgtggtaaataatcatggaggtgcaattttcagtctt
cttcccttggcagataaagttgaacccaacataatgcatcaatatttctacacgtctcat
aacattttgatccatggactatgcacagcacatggtattaaacatttacatgtgaagaca
aaggctgaacttgaagaagctttgtgtgtagttcaacatgaaaagatggattgtttggtt
gagattgagagttccattgaggccaattccaattttcacagtgttttgaaaaaattcgcc
ctccaaactgcacaacataccagaagattcctctcagtgcctttcagtcgaggttctaca
ggagatgagctttatttgaacagaattcgtaaagtggagtgtttaaaatatagaattgca
ctaagtgctccaccaacatctgcttctgactacaataatctaaaggaattgtacagagaa
ggatttattttatctataatccttgcagatggaagtgttggttttggtgaggttgcacct
cttgaaatccacagggaaaatctggttgatgcagaatatcaacttaggtttcttattcat
gttatggagcatgtcgatattggtggttttctctctctattgaagggttcattttcttat
tggatatggaatgagttgggcatcttgccatcttctatttttcccagtgttagatgtggt
ttggaaatggccattcttaatgccatagctgatgcaaaaggctccaacatgttgaacata
ctccatcccccaataaatgaaaatgacaaatgtcaaagttcattagaagctcagatttgt
gcgctaattgattcaaatccatctccaacagaagtggctaatgttgctgccacactagtt
gaggaaggattttctgctatcaaactgaaggttgcacgaaggggtaatccagtgcaagat
gctatattaatacaagaagtgagaaagaaagttggtggccagatcatcatccgtgcagat
gcaaaccgaaaatggacttatgaagaagctatggaattcagctctttggttaaggattgc
aacctgcagtatattgaggagcctgttcagaatgaagatgatattctcaagttctgtgaa
gaaagtggcttacctgttgccctagatgaaaccgtggataaaattcaagaaaatcccctg
gaaaagcttgcaaagtttacacatccaggaatagtcgctgttgttatcaagccaagtgcc
attggtggatttgaaaatgcagcattaattgcacaatgggcacaccggctgggcaaggtg
gctgttgttagtgctgcatttgaaagcagtataagtctagctgcatatactctttttgct
agttatcttgaattgctgagtttaagtacattcaaagtgttagatgaccggaaagtgcct
tccgtagctcacggtttaggaacctatcgttggctaaaggaggatgtagcagctaatcct
cttttgattggttgtagtcctcatagtggttttgttggagcatctgtggcagatgctagt
cgactcctgcatgattttcaagtcaaccaaaatgtcatcagtaatattattgctgagaag
caagttcgtcggtaccaattgaaagtagagcataacagtttttcttgttcttttgaagtt
tttgagactggccaaaaaacaaatgataatgtactagtatttcttcatggatttcttggg
accggtgaagactggattaccatcatgaagaccttttctggatcatcaagatgcatttca
tttgaccttcctggtcatggaaaatcagtagtagattgtgctaaggatactggtgaggag
ccattgtggtcaatggagataattgctgatgtattacaaaaactaatccatcaaataact
ccagcaaaagttacactagtggggtattcaatgggagcaaggattgctttgtacatggca
ctgagatttactagtaagacaatgggagctgtgctaatatctgggagccctggcttaaaa
gataaattatcaagaaaaattcgtgcagctaaagatgattccagagcacgctctgtcatt
gcccatggtttacaaccttttctcaattcctggtatgcgggagcactgtggaaaagctta
agaagccatccccatttcaatcgaatcattgctagtcgcatgcaacatgatggcatgcag
agtcttgcaaagatgctatctggattaagcataggaaggcagccgtcattgtgggaagat
ttgccgaattgcaaagtacctcttcttatcgtacacggagaaatggacatgaagtttaag
aaaattgcagaagcaatgatgaaaacactctgctctgacttgggaagtaagcatgaagaa
gggaatggcatccatgaggtgtttgaggttcccaaatgcggtcatgctgcccatttggaa
aaccctctacctatcatcgatgccttgagacaattcatgacaagactgtaa

DBGET integrated database retrieval system