KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109332939Help
Entry
109332939         CDS       T04664                                 

Definition
(RefSeq) protein STRUBBELIG-RECEPTOR FAMILY 6-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lang01001]
    109332939
Enzymes [BR:lang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109332939
Protein kinases [BR:lang01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109332939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_8 LRR_4 LRRNT_2 LRR_6 Kinase-like DUF5385 SARAF ABC1
Motif
Other DBs
NCBI-GeneID: 109332939
NCBI-ProteinID: XP_019423659
UniProt: A0A1J7HWK5
Position
LG02
AA seq 722 aa AA seqDB search
MEEGGRVVVLFISTCILLWMTIAVNGDTDPNDAASIRILFQGLNSAPQLGWPSNGNGDDP
CGQYWKGITCSVNRVTEINLSNLGLTGTLPYGLKPLTSLTNLDLSNNNLGGTIPYDFPQN
VKRLNLANNNLTGNIPFSFSDLTSLTDLNLGHNEFQQGLSFDFSRLSTLSTLDVSFNALT
GDLPQSLSLLPDITSMYMQNNQFTGTIDILANLPLKDLNVENNHFTGWIPEQLQNINLHT
GGNAWSSGPAPPPPPGTPPAPKSNQHHKHDGGSTSHSGADSGTSDRGKKAGIGGGGIAGI
LISIVVIGAIVAFFLVKRRKSKKSYSDVEKLDNQPFASLPSNELQHEVKLQTSSVIDTKM
FDTSSSINLKPPPIDRHKSFDENELSKKPVVVKKTVTAPANLKSYSIADLQIATGSFSVD
HLVGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPNNLSEDFTDIVSNISHLHHPNVTELVG
YCSEYGQHLLVYEFHKNGSLHDFLHLEDEYSKPLIWNTRVKIALGTARALEYLHEVCSPS
VVHKNIKSANILLDAELSPHLSGSGLASYIPNADQVLNHNIGSGYDAPEVALSGQYTLKS
DVYSFGVVMLELLSGWKPFDSSRPRLEQSLVRWATPQLHDIDALSKMVDPTLKGLYPVKS
LSRFADVIALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTFGSDQGGTPRGSDEPSLR
DF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggtggaagggtggtggtgctgttcatcagtacttgcattcttctttggatg
accattgctgtcaatggtgatacagatccaaatgatgctgcttctataaggattttgttt
caaggtctgaactcggcaccccagttaggttggccttctaatggtaatggtgatgatcca
tgtggacagtattggaaaggaattacgtgctcggttaaccgagttaccgagattaactta
tctaatcttggactgactggaacattgccttacggattaaaacccttgacatctctcacc
aacctagacttgagtaacaacaatcttggaggcaccataccgtacgatttccctcaaaat
gtgaagcgcttaaatcttgctaataataacctcaccgggaatatccctttctctttttct
gatttgacctctcttacggacctgaatcttggtcataatgagttccagcaagggctgagt
tttgacttttcaaggctttctaccctctccacattggatgtctctttcaatgctttgaca
ggtgacctcccacagagtttgagcttgcttccagacataacttccatgtatatgcaaaac
aaccagttcaccggcaccatcgatatccttgctaatctgcctcttaaagatctgaatgtg
gaaaacaatcattttacaggatggataccggaacaattgcaaaacataaacctacatacc
ggtggtaatgcatggagctcaggacctgcacccccgccgcctcctgggacgcctccagcg
cctaaaagtaaccaacaccataaacatgatggtgggagtaccagccactcaggagctgac
agtggcacaagtgacaggggtaaaaaggctggtataggaggtggtggcatagctggaatt
ttgatctccatcgttgtcattggggcaatagtagcgttctttctggtgaagagaagaaaa
tccaagaagtcatattcagatgtagaaaagctggacaatcagccctttgcttctcttcct
tcaaatgaactacaacatgaagtgaagttgcaaacttcctcggtaattgacacgaagatg
tttgatacttcttcctcgataaatctgaaacccccacctattgatcgtcataaatcattt
gatgaaaatgaattgtcaaagaagcccgttgttgtcaagaaaactgtaacagctcctgca
aatttgaaatcatactctatagccgatctgcagattgccactggaagcttcagtgtggat
caccttgtcggtgagggatcttttggacgtgtttaccgtgctcaatttgatgacgggaag
gttcttgcagtgaagaagatagactcatctgtccttccgaataatttgtctgaagatttt
acagatatagtttcaaacatctcccatttacatcatccaaatgtgactgagcttgtaggt
tattgttcagagtatggacagcatctcttagtctacgagtttcacaaaaatggttcgctg
catgacttccttcacctagaagatgaatatagtaaaccattgatatggaatacacgtgtc
aagattgctttgggaactgcacgtgctttagagtacctacatgaagtttgttcgccatca
gttgttcataagaatattaagtcagccaacatattgcttgatgcggagcttagtcctcat
ctttcaggcagtggattagcaagctatattccaaatgcagaccaggtattgaaccataat
attggatctggatatgatgcacctgaagttgctttgtctggtcagtataccctgaaaagt
gatgtctatagctttggagttgtcatgttggagcttctcagtgggtggaaaccatttgac
agctcaaggccaagattggagcagtctttggttagatgggcaacacctcaactccatgat
attgatgcattgtctaaaatggttgatcctacactgaaagggttataccctgttaaatct
ctttctcgttttgctgatgttattgctctttgcgttcagtcggagcctgaattccgacca
cctatgtcagaagtggttcaagcacttgttcggttggtgcagcgagcaaacatgagcaag
agaacatttggatctgatcaaggaggaacccctcgagggagtgatgaacctagcttgaga
gacttctaa

DBGET integrated database retrieval system