KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109334156Help
Entry
109334156         CDS       T04664                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03040  Spliceosome
lang04141  Protein processing in endoplasmic reticulum
lang04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109334156
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109334156
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109334156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FtsA FGGY_C Hydantoinase_A PilM_2
Motif
Other DBs
NCBI-GeneID: 109334156
NCBI-ProteinID: XP_019425290
UniProt: A0A4P1QP54
Position
LG19
AA seq 699 aa AA seqDB search
MAYSTAQIHALATPSFLNPNPRTTLFLGHRLNAKPFHRSAFINLKTNTRRYNVAPLRVVC
EKVVGIDLGTTNSAVAAMEGGKPTIITNSEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVN
PENTFFSVKRFIGRKMVEVDEESKQVSYRVVRDDNGNVKLDCPAIGKQFAAEEISAQVLR
KLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGF
ERKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLASNFKR
DEGIDLLKDKQALQRLTETAEKAKMELSSLTQTNISLPFITATADGPKHIETTLTRAKFE
ELCSDLLDRLKTPVENSLRDAKLSFKDLDEVILVGGSTRIPAVQELVKKLTGKDPNVTVN
PDEVVALGAAVQAGVLAGDVSNIVLLDVTPLSIGLETLGGVMTKIIPRNTTLPTSKSEVF
STAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSV
TAVDKGTGKRQDITITGASTLPSDEVQRMVNEAEKFAKEDKEKRDAIDTRNQADSVVYQT
EKQLKELGDKVPGPVKEKVEAKLGELKEAITGGNTQTLKDALAALNQEVMQLGQSLYNQP
GAPGAGPTPPGADAAPGASESSSKGPDGDVIDADFTDSK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattccacagctcaaatacacgctctcgcaaccccttcattccttaatcccaat
ccgagaacaacactattcctcggccacaggctcaacgcaaaacccttccatcgctccgct
ttcattaacctcaaaacaaacacaaggcgttacaacgtcgcacctctcagggttgtatgc
gagaaagtcgtcggcatcgatctcggaaccaccaactccgccgtcgcagccatggaaggt
ggaaaaccaactatcataacaaactccgagggacagagaactacaccgtctgtggttgca
tatacaaagaacggtgacaggcttgttggtcaaattgcaaagcgtcaagctgtggtgaac
cctgagaatacgttcttctcagtaaaaaggttcattggaaggaaaatggttgaagttgat
gaagaatccaaacaggtttcttatagagttgttcgtgatgataatggcaatgttaaactt
gattgtcccgcaattggaaaacaatttgcagctgaagaaatttcagctcaggttttgagg
aagcttgttgatgatgcttcaaagtttttgaatgataaagtgactaaggctgtggtgaca
gtgcctgcatattttaatgattctcaaaggactgctactaaggatgctggtcgtattgcc
ggtttagatgttcttcgaattatcaatgaacctactgctgcttcacttgcctatggtttc
gaaaggaaaaacaatgagacaatcttggtttttgaccttggtggtggcacttttgatgtc
tcagtgcttgaggttggtgatggagtgttcgaggtgttgtctacttctggagatacacac
ttgggtggtgatgactttgacaagagagttgtggattggttggcttccaacttcaagagg
gatgagggaattgatcttttgaaagataaacaagctcttcaacgtcttaccgagacagct
gagaaagcgaaaatggagctatcatctttgactcaaaccaacatcagtttgccattcata
actgctacagcagatggtcccaagcatatcgagaccacccttacaagggctaagtttgag
gaattatgttcagatcttcttgacaggctcaagacaccggttgaaaattcattgagggat
gcaaaactctcattcaaggatttggatgaggtgatcctcgtgggtggatcgacacgtatc
cctgctgttcaggagcttgtaaagaaactgactgggaaagaccctaatgtcacagtcaac
ccagatgaagtggtcgcccttggagctgcagttcaggccggtgtcttggctggagatgtt
agcaacattgtgctattggatgttactccattatctattggtctggaaactctaggtggt
gtgatgaccaaaattatccctagaaacactactctccctacctcaaaatcagaggttttc
tcaacagcagctgatggacagaccagtgtagagatcaatgtccttcagggagagagagaa
ttcgtgagggataataaatctcttggtagcttccgcttggatggtatccctcctgcacct
cgtggggttcctcagatcgaggtaaagtttgacatcgatgccaatggcatcctctcagtc
actgcagtagacaagggtacagggaagaggcaagatattaccattactggtgctagcacc
ttgcctagtgacgaggtacaaaggatggtaaacgaggctgagaaatttgccaaggaagac
aaggagaagagggatgccattgacacgagaaaccaggcggattctgttgtgtaccagact
gagaagcaattgaaagagcttggagacaaggttcctggcccagtgaaagagaaggttgaa
gccaaactgggtgagcttaaagaagcgattaccggcggtaacacccaaactcttaaggat
gcattggctgcccttaaccaggaagttatgcagcttggccagtcactatacaaccagcca
ggagccccaggggcagggcctacaccacctggtgctgatgctgctcccggtgcttctgaa
tcatcaagcaaaggacccgatggggatgtgattgatgcagattttactgactccaaatga

DBGET integrated database retrieval system