KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109334832Help
Entry
109334832         CDS       T04664                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00350  Tyrosine metabolism
lang00360  Phenylalanine metabolism
lang00380  Tryptophan metabolism
lang00950  Isoquinoline alkaloid biosynthesis
lang00965  Betalain biosynthesis
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109334832
   00360 Phenylalanine metabolism
    109334832
   00380 Tryptophan metabolism
    109334832
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109334832
   00950 Isoquinoline alkaloid biosynthesis
    109334832
   00965 Betalain biosynthesis
    109334832
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lang04147]
    109334832
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109334832
    4.1.1.105  L-tryptophan decarboxylase
     109334832
Exosome [BR:lang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109334832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 109334832
NCBI-ProteinID: XP_019426352
Position
LG19
AA seq 492 aa AA seqDB search
MEEKEEGSGLRSMDSEQLREEAHKMVDFIADYYKTIENFPVLSQVQPGYLGKLLPDSAPD
HPEPLQHVLNDIQEKILPGVTHWQSPNYFAYFPSNSSIAGFLGEMLSAGLNIVGFSWITS
PAATELETIVLDWLAKALNLPDDFYSTGQGGGVIQGTASEAVLVVLVAARDKILRRVGRS
ALNKLVTYASDQTHSALQKACQIGGLNPELCRLLKTDSSTNYALSPDVLSEAISSDITSG
LIPFFLCATVGTTSSTALDPLPALGRIAKINNIWFHVDAAYAGSAGICPEYRHHIDGVEE
ADSFNMNAHKWFLTNFDCSLLWVKDRSALIQSLSTNPEFLKNKASQENMVIDYKDWQIPL
GRRFRSLKLWMVLRLYGLEGLRSYIRNHIDLAAYFEELVAQDARFKIVVPRTFSLVCFRV
LPPPNSEDHGNKLNHDLLDSVNATGNVFITHTVLSGQYILRLAVGAPLTEKRHVKGAWQI
LQDKATALLGSL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagaagaaggaagtggattaaggagcatggattctgagcaattaagagag
gaagctcataagatggttgatttcattgctgattactacaaaaccattgaaaattttcct
gttctaagccaagttcagccaggttaccttgggaaacttttgccagattctgcacctgac
caccctgagccattgcaacatgttctgaatgatatacaggaaaagatactgccaggggtg
acacattggcaaagcccaaattattttgcatattttccttccaacagtagcattgctgga
ttcctaggagaaatgctgagtgctggtcttaacattgtgggtttcagctggataacttct
cctgctgcaactgaacttgaaactattgtgctggactggcttgcgaaggcacttaatctg
cccgatgatttttattctaccgggcaaggtggtggagttatccagggaacagcaagtgaa
gctgtgctagttgtcttggtggctgcccgtgataagatcttacggagggtcggaaggagc
gcccttaataagcttgttacatatgcatctgatcaaacacactctgctttacaaaaagcc
tgccagataggaggacttaatccagagctttgcaggttgcttaaaactgattcttccaca
aattatgcactttctcctgatgtactttctgaagcaatttcaagtgacattaccagtggt
cttataccttttttcttatgtgctactgtcggaaccacttcatcaacagctcttgatcct
cttcctgcattagggagaattgctaagatcaacaacatttggtttcatgtcgatgctgct
tatgctggaagtgctggtatatgtccagagtaccgccaccacattgatggtgttgaagaa
gcagactcatttaacatgaatgcgcataaatggttcctgacaaactttgactgttcgcta
ctttgggttaaggacaggagtgctctaattcagtcactgtctacaaatcctgaatttctg
aaaaataaggcatctcaagaaaacatggtcatagattacaaagattggcaaattcctctt
ggacgccgctttagatcattaaaattgtggatggtgttacgtctctacggattggaaggt
ttgcgaagttacataagaaaccatattgacttggctgcttatttcgaggagcttgttgct
caggatgcaagattcaagatcgttgtgcctcgcacattctctttagtttgttttcgggtt
ttgcctcctccaaactctgaagatcacggcaataaactaaatcatgatctactcgactca
gtaaatgcaacaggaaatgtattcataacacacacggttctttcgggtcagtacattcta
cgtttggcagtaggagcaccattgacggaaaagaggcatgtcaagggagcatggcagatt
ttgcaagataaagccactgctcttcttgggagcttataa

DBGET integrated database retrieval system