KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109336634
Entry
109336634         CDS       T04664                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00100  Steroid biosynthesis
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Module
lang_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109336634
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109336634
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 109336634
NCBI-ProteinID: XP_019428896
Position
LG20
AA seq 369 aa
MDLGFLLHSLIPSWNSVVLLVGFFTYLAIAGSIVPAKLVPGVLLPDATRLHYRCNGLVSL
LLLVALLGISANLGFISPTAIADRGLELLSTTFIFSFLVSLILYFAGYKSKSKGSSLKPH
IGGNLIDDWWFGIQLNPHFTGIDLKFFFVRAGMMGWLLINLSVIAKSIDAGTLDSSMILY
QLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLKNKVELT
TAAIVANCFVFLIGYKVFRGANKQKHDFKKNPKALIWGKPPKVIGGKLLASGYWGVARHC
NYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAQYSKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttctacttcactctctaattccatcttggaactccgttgttttactt
gtgggattctttacttacttggctattgctggatccattgtccctgcaaaacttgttcct
ggggttcttctacctgatgcaactcgtcttcactaccgttgcaatggtctagtctccctt
ctactgttggttgcgctacttgggatcagtgccaatttgggttttatatctcctactgct
atagcagacagaggactggagttgctgtccacaactttcatcttcagttttcttgtgagc
ctgatactctattttgccggttacaagtcaaaaagtaaaggctcatcactaaaacctcat
atcggtggaaacttgatagacgattggtggtttggcatacaacttaatcctcactttact
ggtattgacctcaaatttttctttgttagagctggaatgatggggtggctacttatcaat
ctatcagttattgcaaagagcattgacgctggtactttggattcgtcgatgattctctac
cagctattctgtgcactatacatcctggattactttgtacatgaagagtacatgacatcc
acctgggacattattgcagagagactgggcttcatgttggtcttcggagatttagtgtgg
attcctttcacttttagcatacagggttggtggctcttgaagaacaaggtcgagttaaca
accgctgccattgtagctaattgctttgtcttcctgattgggtacaaggtatttcgaggt
gcgaacaagcaaaaacatgacttcaaaaagaatccaaaggctcttatatggggtaagccc
cctaaagtcattggaggcaagctacttgcttctggttattggggtgttgctagacattgt
aattacctaggggacttgatgcttgctctctccttcagtttaccttgtggaataagttca
ccagttccgtacttctatccaatttatcttctgattctgttaatctggagagagagaagg
gatgaagctcgttgtgcagagaagtataaagaaatctgggctcagtatagtaaacttgtt
ccatggagaatattaccttatgtgtattag

DBGET integrated database retrieval system