KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109336663Help
Entry
109336663         CDS       T04664                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109336663
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lang03012]
    109336663
Translation factors [BR:lang03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109336663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI TRI5
Motif
Other DBs
NCBI-GeneID: 109336663
NCBI-ProteinID: XP_019428945
Position
LG20
AA seq 930 aa AA seqDB search
MASRFWTQGGSDSEEEESDYDEEVVATAGESASQAVASKYMDNGSDSDDSDGQKRTVRSA
KDKRFDEMSSTVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVIESAKVPTLYIKALVM
LEDFLAQALANKDAKKKMSSSNAKALNSMKQKLKKNNKQYEDLINKFRENPESEGEKDEE
ETEEEYETDDEIIEPEQLKKKEALSDSEGSRYDDEKQDPNETPWDQKLSKKDRLLDRQFM
KDPSEITWDIVNKKFKEVVAARGKKGTGRFEQVEQLTFLTKVAKTPAQKLEILFSLVSAQ
FDVNPGLSGHMPIKVWKKCLQNMLVILDILVQYPNIVVDDSVEPDENETQKGVGYNGPIH
IWGNLVAFLERIDTEFFKSLQCIDPHTSEYVERLRDEPTFLVLAQNVQEYLARVGDMKAA
SKVALRRVELIYYKPQEVYDAMRKLAELTEDGGIGGDASEESKGFEETRTPTAFVVTPEV
VPRNPTFPENSRALMDILVSLIYKYGDERTKARAMLCDINHHALLDEFSVARDLLLMSHL
QDSVQQMDISTQILFNRTMAQLGLCAFRVGLISESHGCLSELYSGGRVRELLAQGVSQSR
FYEKTPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAANVHDAKRKVISKTF
RRLLEVNEKQTFTGPPENVRDHVMAATIVLTKGNFNKAFDIIQSLGVWKFVRNRDAALGM
LKDQIKEEALRTYLFTFSSSYDSLSLDQLTKMFDLSVSRTHSIVSRMMINEELHASWDQP
TGCIIFQDVEHSRLQGLAFQLTEKLSILSESNERATEARIGGGGLDLPLRRRDNQDYAAA
AGGAATSGGRWQELSFSQQRQGGGSGRGGYNTGRGRQSAFGQAAGSGYSRDRTGRVTGAG
YQRSAHSGSAPRGSQVDASTRMVSLKGVRA
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagattttggactcagggtggtagtgattctgaggaggaggagagtgactat
gatgaggaggttgtggcaacagcgggtgaatctgctagtcaagccgttgcaagcaaatac
atggataatggcagcgatagtgatgactcagatggccaaaagcgtactgtcaggtcagca
aaagacaaacgttttgatgagatgtcatcgactgttgatcagatgaagaatgccatgaag
attaatgactgggtaagtttacaggagagctttgacaagatcaacaagcaacttgagaaa
gtcatgcgtgttattgaatctgcaaaggtgcccactctttatataaaggcacttgtaatg
ttggaggatttcttagctcaggctttggcaaataaggatgccaaaaagaaaatgagtagc
agcaatgctaaagccttaaactcaatgaagcagaaattgaagaagaataataagcagtat
gaggatttgattaataaatttagggagaatcccgagagtgagggggaaaaagatgaagag
gagacagaggaagagtatgaaactgatgacgagattattgaaccagaacagctaaaaaag
aaagaagcactatcagattctgaaggttctcgctatgacgacgagaagcaagatcccaat
gaaacaccatgggaccaaaagcttagcaagaaagacaggcttttggataggcaatttatg
aaagacccaagtgagatcacttgggatatagttaacaaaaagttcaaagaggttgtggca
gctaggggtaagaagggaactggaaggtttgaacaggttgagcagcttaccttcctaaca
aaagttgctaaaacacctgcacagaaactggaaattctttttagtctagtttctgctcag
tttgatgttaatccaggtcttagtgggcatatgccaattaaagtgtggaaaaaatgctta
cagaacatgctagtcattcttgatattctagtgcagtacccaaacatagttgttgatgat
tcagtggagccagatgagaatgaaactcagaagggggtgggctataatggacccattcac
atttggggtaacttagttgcattcttagaaagaatagatactgagtttttcaagagcctt
cagtgcatagatcctcatacttctgagtatgttgagagactgagggatgaacccacattt
cttgttcttgctcagaatgtccaggaatatctggcaagggttggggatatgaaagcagct
tctaaggtagctttgaggcgagtggaactcatttactacaaaccgcaggaggtttacgat
gccatgagaaagttggctgagctgactgaagatgggggtattggaggggatgctagtgag
gagtctaaaggatttgaagaaacaaggacacctactgcatttgttgttactcctgaggtt
gttcctaggaaccccacttttccggagaatagcagggccctaatggatatattggtatcc
ctaatatataaatacggagatgagcgcactaaagcacgtgcaatgctttgtgatataaat
catcatgctctgctcgatgagttctcagtagcacgtgatctgctgcttatgagccatttg
caggacagtgttcaacaaatggacatttcaacacaaatactttttaacaggactatggct
cagctgggtctatgtgcttttcgggttggattgatttctgagtcacatggctgtctctct
gaactttattctggtggcagggtgagggaattacttgctcaaggtgtgtcacaaagtcgt
ttctatgagaagacccctgaacaggaaaggttggaaaggaggcgtcaaatgccatatcat
atgcacataaaccttgagctcctagaggcagtgcatcttatttgtgctatgttgctggaa
gtccctaacatggctgccaatgtccatgatgcaaagcgcaaggtcatcagcaagactttc
cgtcgtttgcttgaggttaatgagaaacaaactttcactggtccacctgaaaatgtcaga
gatcatgtcatggctgccacgatagttcttaccaagggaaacttcaacaaggcttttgat
atcattcagtctcttggtgtatggaaattcgttaggaaccgtgatgctgcacttggaatg
ctgaaggaccaaatcaaggaggaggcactgagaacatacctctttacattctcatcatct
tatgattctttgagcctggatcagctcacaaaaatgttcgatctctctgtttctcgcact
catagtattgttagtcgaatgatgatcaacgaggagcttcatgcaagctgggaccagcca
actgggtgcattattttccaggatgttgagcactcaaggctgcagggtttggcattccag
ttaacagagaaattatctatcctttctgagagtaatgaaagagcaactgaggcaaggata
ggcggtggtggattggatctgcctctaaggcgacgcgataaccaggactatgctgctgct
gccggtggagctgccacttcaggtggtaggtggcaagagttgtccttttctcagcaaagg
caaggaggaggtagtggtcgtggaggatataatactggtcgtgggaggcaatcagcattt
ggccaagctgctgggagtggctattcaagggaccgaaccggacgagtaacgggtgcaggt
tatcagaggtctgctcatagtggatcagcaccgagaggatcccaggtggatgcttctact
cgcatggttagtctaaagggagttcgggcttga

DBGET integrated database retrieval system