KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109336860Help
Entry
109336860         CDS       T04664                                 

Definition
(RefSeq) phospholipid hydroperoxide glutathione peroxidase, chloroplastic-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00480  Glutathione metabolism
lang00590  Arachidonic acid metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109336860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109336860
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109336860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 109336860
NCBI-ProteinID: XP_019429220
Position
Un
AA seq 245 aa AA seqDB search
MQFPTTQMASMAYSTTFFTPFHDFTQFRTNPPIPSVPFIKTCSFGSSNSAFFQHHGFSQQ
TTSSSLPRFLIKPKSFSLHARAATEKTIYDFTVKDIDRKDVPLSNFKGKVLLIVNVASRC
GLTSSNYSELAHIYEKYKTQGLEILAFPCNQFGMQEPGSNLEIKEFACTRFKAEFPIFDK
VDVNGPFTVPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQ
KLLAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccaaccacccaaatggcttcaatggcttattctaccactttcttcacacct
tttcatgatttcactcaatttagaacaaacccaccaattccttctgtgcctttcatcaaa
acctgttcctttggttcctccaactcagcttttttccaacatcatgggttttcacaacaa
accacatcttccagtcttcctaggtttcttatcaagcctaaatctttctcacttcatgca
agagcagccactgagaaaaccatttatgattttactgtcaaggatattgaccggaaggat
gttcctctaagcaattttaaagggaaggttcttttaattgtcaatgttgcttcaagatgt
ggtttgacatcatcaaactactcagaactggcacacatatatgaaaaatataaaactcaa
ggtctggagattctagctttcccctgcaaccagtttggtatgcaggagcctggatctaat
ctagaaattaaggagtttgcttgcactcgttttaaagcagaatttccaatttttgataag
gttgatgtaaatggaccattcacagttccagtatatcagtttctgaaatcaagtgctgga
ggcttcctaggtgatcttataaagtggaattttgagaaattcttggttgataaaaatggt
aaagttgttgaaagatacccaccaacaacctctccttttcaaattgagaaggatatccaa
aagttattggcggcttaa

DBGET integrated database retrieval system