KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109337765Help
Entry
109337765         CDS       T04664                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00010  Glycolysis / Gluconeogenesis
lang00053  Ascorbate and aldarate metabolism
lang00071  Fatty acid degradation
lang00280  Valine, leucine and isoleucine degradation
lang00310  Lysine degradation
lang00330  Arginine and proline metabolism
lang00340  Histidine metabolism
lang00380  Tryptophan metabolism
lang00410  beta-Alanine metabolism
lang00561  Glycerolipid metabolism
lang00620  Pyruvate metabolism
lang00903  Limonene and pinene degradation
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109337765
   00053 Ascorbate and aldarate metabolism
    109337765
   00620 Pyruvate metabolism
    109337765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109337765
   00561 Glycerolipid metabolism
    109337765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109337765
   00310 Lysine degradation
    109337765
   00330 Arginine and proline metabolism
    109337765
   00340 Histidine metabolism
    109337765
   00380 Tryptophan metabolism
    109337765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109337765
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109337765
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109337765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 DUF1350
Motif
Other DBs
NCBI-GeneID: 109337765
NCBI-ProteinID: XP_019430354
Position
Un
AA seq 551 aa AA seqDB search
MAAGRVSSLLSCSLSSSMANPSFASQLQTLGNQKPIYLKGRKTKTWRNINRFNTAAQVDE
LITPPVEIRYTKHLINGQFVEAASGKTFPTYDPRTGEVIAHVSEGDEEDINRAVSAARKA
FDEGPWPKMTAYERSRILLQIADLVEKHSDELAALETWNNGKLYEQAAKIELPIFVRLLR
YYAGWADKIHRLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLLFSWKVGPALACGNTLV
VKTAEQTPLTGLFAAQLFHEAGLPPGVLNVVSGFGPVAGSALASHMDVDKIAFTGSTETG
KIIYQLAAKSNLKPVTLELGGKSPFIVCEDADVDKAVELAHFAQFFNQGQCCCARSRTYV
HERIYDEFLEKAKATALKRVVGDPFKKGVEKGPQIDSKQLEKILGHIRSGIECNATLECG
GERIGKKGFFLQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDTEEVIRRANKTRYGLAAG
VFTKNLDTANTLMRGLRAGTVWINCFNVFDAAIPFGGYKMSGVGREKGIYSLHNYLQVKA
VVTPLNDPAWL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggcagagtttcctccttgctttcttgctctctatcttcctccatggctaat
cccagctttgcatctcagcttcagacattaggtaaccaaaaacccatttatctcaaagga
agaaaaaccaaaacctggagaaacatcaacaggttcaacactgctgcacaagttgatgaa
ttaatcacaccacctgttgaaataagatacaccaagcatctaataaatggacaatttgtg
gaagctgcatcaggaaaaacatttcctacatatgatccaagaactggagaagtgattgct
catgtttcagagggtgatgaagaggatatcaaccgtgcagtatctgcagctcgaaaggct
tttgatgaaggaccatggccaaagatgactgcttatgaaagatcacggatactactgcaa
attgcggatttggtcgagaaacatagcgatgagcttgccgcactggaaacgtggaataat
ggcaaactctatgaacaagctgccaaaattgaattaccaatttttgtacgtctgcttcgc
tactatgctggttgggcagataaaattcatcgtctcacagttccagctgatgggaattat
catgtacaaacattgcatgagccaattggggttgcaggacaaatcataccttggaacttt
cctctattgttattttcttggaaagttggccctgcactagcatgtggtaatactttagta
gtaaagacagccgagcaaacacctttgactggattatttgcagcacagctatttcatgag
gctggtctacccccaggggttctaaatgttgtgtctggttttggtccagttgctggttct
gctcttgccagtcatatggatgtggataagatagcttttactggatcaactgaaacgggc
aaaattatataccaattggctgcaaaaagcaaccttaagccagtgactttggagcttgga
ggaaaatcacctttcatagtgtgtgaggatgctgatgttgacaaggctgttgaacttgca
cactttgctcagttctttaatcagggtcaatgttgttgtgccagatcacgcacttatgtt
catgaacgaatatatgatgagttcttggagaaagccaaggcaactgctttgaaacgtgtt
gttggtgatcctttcaagaaaggcgttgagaaaggtcctcagattgattccaaacaatta
gagaaaatccttggacacatcagatcaggtattgaatgcaatgctactctggaatgtggt
ggtgaacgaattggcaaaaaaggcttctttcttcagccaacggtcttctctaatgttcag
gatgatatgctgatagcaaaagacgagatctttggccctgttcaaaccatcctgaaattc
aaggacactgaagaagttataagaagagcaaacaagacacgttatggtcttgctgctggc
gtgttcaccaagaacttggacacggccaatacattgatgcgaggactgagggctggaact
gtatggatcaattgcttcaatgtgtttgatgctgcaattccttttggtgggtacaagatg
agtggggtagggagagagaagggtatatacagccttcataactatttgcaggttaaggct
gtggttacacctctcaatgatcctgcatggctgtaa

DBGET integrated database retrieval system