KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109337984Help
Entry
109337984         CDS       T04664                                 

Definition
(RefSeq) transcription factor TCP11-like
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
SSDB OrthologParalogGFIT
Motif
Pfam: TCP
Motif
Other DBs
NCBI-GeneID: 109337984
NCBI-ProteinID: XP_019430649
UniProt: A0A394DAP5
Position
Un
AA seq 207 aa AA seqDB search
MASSEVVFHHTFSQSKTNVSTTTTTTVSDNNASITVARRLPATSSRSTKDRHTKVNGRGR
RVRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGTGTVPAESVSTASATF
ASSAPSVPCNVQPVSSASGGSHGMFATVALQQCQPSCRLDLCQPEAGLEYAAVAAATNGY
RHMPFTALLLQPATAEDTQQKESLSEQ
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcagaagttgttttccatcacacattctctcaatcaaagaccaatgtctca
acaacaaccaccaccaccgtctccgacaacaatgccagcatcaccgtcgcgagaagactt
cccgccacctcctcccgttcaacaaaggaccgtcacaccaaggtaaacggccgaggccgc
cgcgtacggatgccgcctctctgcgccgccagaatattccagctcacccgcgaactcggc
caccgctccgacggtgaaaccatcgagtggcttctccgccacgccgaaccatccataatc
gccgccactggcaccggcacagtccccgcagaatcggtatccactgcctcagccaccttt
gcctcttccgctccctccgttccctgcaatgttcagcccgtatcctctgcttccggcggt
agccatgggatgttcgccacggtggcgcttcagcagtgtcagccgagttgccgtctcgac
ctgtgccagccagaggcggggttggagtacgccgcggtggctgcggctacaaatgggtac
cggcacatgccgttcacagcgctgttgttgcagccggcgacggcagaggatactcaacaa
aaagagagtctcagcgaacaatga

DBGET integrated database retrieval system