KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109341281Help
Entry
109341281         CDS       T04664                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00020  Citrate cycle (TCA cycle)
lang00640  Propanoate metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109341281
   00640 Propanoate metabolism
    109341281
Enzymes [BR:lang01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109341281
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109341281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 109341281
NCBI-ProteinID: XP_019434694
UniProt: A0A1J7FN43
Position
Un
AA seq 329 aa AA seqDB search
MARQTITKLMLSIASRTKTSQIRHFTASPAPPPAVFVDKNTRVICQGITGKNGTFHTEQA
IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETRANASVIYVPPPFAAAAILEALEA
ELDLVVCITEGIPQHDMVRVKAAINSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR
IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIVLI
GEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTL
REAGVTVVESPAKIGAAMLDVFKQRGLVQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaaaccatcacaaaattaatgctctcaattgcatcacgcactaaaacctct
cagatccgccacttcacggcgtctccggcgccacctcccgccgtcttcgttgacaagaac
acccgcgttatctgccaaggcatcaccggcaagaacggaacttttcacacagaacaagcc
atcgaatatggaaccaaaatggtaggtggtgtaacaccaaagaagggtggaacagaacac
ttgggacttcctgtctttaacactgttgctgacgcaaaggctgaaacaagggccaatgct
tctgtcatttatgttcctccaccatttgccgcagctgccattttggaggcattggaggca
gaattggatcttgttgtctgcattaccgaagggattccacagcatgatatggtacgagtt
aaagctgcaattaacagtcaatccaaaactcgtctgataggaccaaactgccctggtatc
atcaagcctggggagtgtaaaattggaatcatgccaggttacattcataaacctgggcgt
atcggaattgtttctcgttctggaaccttgacatatgaggcggttttccaaacaactgct
gttggccttggtcaatccacttgtgtgggtatagggggggatccctttaatggaacaaac
tttgtcgattgccttcaaaaattcctaacagatccccagacagaaggtatagttcttata
ggagagattggtggaactgcagaagaggacgctgctgcactgattaaggaaagtgggact
gagaagcctgttgttgcatttattgctggattaactgctcccccgggccgtcgtatgggt
catgctggagctattgtgtcaggtggaaagggtactgcacaagacaaaattaagacactc
agagaagcaggggtcacagtagtggagtcccctgctaaaattggagctgccatgctagat
gttttcaagcagaggggcttggtgcaatag

DBGET integrated database retrieval system