KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109342442Help
Entry
109342442         CDS       T04664                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109342442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lang03041]
    109342442
Enzymes [BR:lang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109342442
Spliceosome [BR:lang03041]
 Complex C
  Other components
   Step II factors
    109342442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 DEAD AAA_22 AAA_19 Helicase_RecD ABC_tran AAA_29 ResIII AAA_23 AAA_30 Med8 RsgA_GTPase AAA_25
Motif
Other DBs
NCBI-GeneID: 109342442
NCBI-ProteinID: XP_019435970
Position
LG03
AA seq 873 aa AA seqDB search
MNTFNQPSSGVTTRHHNFNSHRQSPSQQPPPPPPSYGVQTSHPPHNSFHHWNPGVSNPPD
KTSTLRRPNFDITLRTGRRSFRRDEFLALISECDLKPEFKSFPASDRIAGVIGFRQWCDA
LDAVVWFWKTRLNEIHDLMPELTSYVIVPSDMNELERRLKALFTYHVKCLMNEGKEVKRL
NVEIDRLSKEIDSFCKVLSKPLPIPVYNQRVEKKKGLVAEKNLIEKRIREFKNAMECLVK
KFEEEEEDDDEEEGKNNKVLEDEESVVSVFKFEGRLDWKKVHCMIMRERKRLEQGLPIYA
YRSDIIQQVHSHQVTVLIGETGSGKSTQLVQFLADSGVGANESIVCTQPRKIASKSVSER
VQEESSGCYGDNTIKNYSTFSSSKCFDSRITFMTDNCLLQHYMDDKNLFGVSCIIIDEAH
ERSLNTDILLAVIKNLLSRRVDMRLIIMSATADAEQLSDYFYGCGILHVLGRNFPVDVKY
VPSDNMEHSGSAVIIALYVSDVVRMATEIHKTEKEGSILAFLTSQVEVEWACDKFRDTSA
VALPLHGKLSSEEQFHVFQNYSGKRKVIFATNLAETSLTIPGVKYVIDSGFVKDCRFDPS
SGMSVLKVCRISQSSALQRAGRAGRTEPGRCYRLYSEDDFQSMEPTQEPEIRRVHLGVAV
LRILALGVKNVQEFDFVDAPSSRSIEMAIKNLIQLGVITLNKNVYGLTHEGRCLVRLGVE
PRLGKLILGCCRYGMGREGVVLAALMANASTIFCRVGNEDDKQRSDCHKVQFCHCDGDLF
TLLSVYKEWEALPRDSKNKWCWENSINAKSMRRCQDIVVELESCLERELCIVTPNYWHWN
PYKPSDYDEYLKKVILASLAENVAMYSGCDQLA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttcaaccaaccaagtagcggtgtcaccacgcgccaccacaacttcaattcc
caccgtcaatcaccatcacaacaaccaccaccaccaccaccttcttacggtgttcaaaca
tctcatcccccacacaactcgttccaccactggaatcctggtgtcagtaacccaccggac
aagacctccaccctccgccgtccaaatttcgacatcaccctccgcaccggccgccgctca
ttccggcgagatgaattcttggcgctaatctccgaatgcgacttgaagccggagttcaag
tcctttcccgcttccgaccgcatcgccggcgtgatcggtttccggcagtggtgcgacgcc
ttagacgccgtcgtttggttctggaagactcgcctgaatgaaattcacgatctcatgccg
gaactcacttcgtatgttatagtaccttcggatatgaacgaactcgaacgtagattgaaa
gccctatttacttaccacgtgaagtgtttgatgaatgaagggaaagaggttaaacgattg
aacgttgaaatcgatcgattatcgaaagagattgatagtttttgtaaggtactgagtaaa
ccgttgccaattccggtttataatcagagagtggagaagaagaaagggcttgtagctgag
aagaacctaattgagaagagaataagagaatttaagaatgcaatggagtgtttggttaag
aaatttgaagaagaggaagaagatgatgatgaagaagaagggaagaataataaggtgttg
gaggatgaggaaagtgttgtttctgtgtttaagtttgaaggaagattggattggaaaaag
gttcattgcatgatcatgagagaaaggaagagacttgaacaagggttaccaatatatgct
tataggagtgatattattcagcaagttcattctcatcaggtaacagtgttaattggagag
actggctctggaaagagtacacagttggtacagttcttagctgattcgggtgttggtgct
aatgagtccattgtatgcacccaacctcgtaaaattgcttccaaatcggtgtctgaaagg
gtacaggaagaaagcagtggatgttatggagacaacactatcaagaattattctaccttt
tcatcatcaaagtgttttgattccagaattacattcatgacagacaactgtttattgcag
cactatatggatgacaagaatctgtttggggtctcgtgcatcataattgatgaggctcat
gaaaggagcttaaatactgatatcttgttggcagtgatcaagaatttactcagtaggagg
gttgacatgcggcttatcattatgtctgctacagctgatgcagagcagctatctgattat
ttctatggatgtggaattcttcatgtgcttgggagaaactttccagtggatgtgaaatat
gttccttctgacaacatggaacattctggttctgctgttattattgccttgtatgtgtct
gatgttgtcagaatggcaactgagattcacaaaacagagaaagagggatctatccttgcc
tttctgacctcacaggtagaagtagagtgggcctgtgataagtttagagatacctctgca
gttgctttgcccttacatggaaaactttcgtctgaagagcaatttcatgttttccagaat
tactctggaaaaagaaaagtgatatttgcaacaaatcttgcagagacatcacttacgatt
cctggtgttaagtatgtgatagattctgggtttgttaaagactgccggtttgatcctagc
agtgggatgagtgtacttaaggtttgccggatcagccagagttctgctcttcaacgggct
ggtcgtgctgggcgaactgagcctggtaggtgctatagactgtactcagaagatgatttt
cagtctatggaaccaacccaagaacctgagattcggcgagttcatcttggtgtagcagtt
ttgaggatccttgctttaggagtgaagaatgtgcaggaatttgattttgtggatgctcca
agttctagatctattgagatggcgatcaagaatctaattcaactaggagtcattacactg
aacaaaaatgtttatggattaacacatgaaggcagatgcttggtaagattgggggttgaa
cctaggcttggtaaactcattcttggctgttgccgttatggtatgggtagagaaggcgtt
gtccttgctgctttgatggccaatgccagcacaatattttgcagagttggtaatgaagat
gataagcaaagatccgattgtcataaagttcaattttgccactgtgatggtgacctcttt
actctactctctgtgtacaaggaatgggaagctttgcctcgagacagtaagaacaaatgg
tgttgggaaaacagcatcaatgccaaatcaatgaggagatgccaagacattgttgtggag
ttagaatcttgtcttgaacgtgaactatgcattgttactccaaattactggcattggaac
ccttataagccctctgattatgatgagtatctgaagaaggttatactagcttcacttgcc
gagaatgtagccatgtactctggatgtgaccaacttgcttga

DBGET integrated database retrieval system