KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109343149Help
Entry
109343149         CDS       T04664                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109343149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lang03041]
    109343149
Enzymes [BR:lang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109343149
Spliceosome [BR:lang03041]
 Complex C
  Other components
   Step II factors
    109343149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Flavi_DEAD Sigma54_activ_2 ABC_tran AAA_16 AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 109343149
NCBI-ProteinID: XP_019436858
UniProt: A0A1J7IMS8
Position
LG03
AA seq 1217 aa AA seqDB search
MAEDNLDEGLKKKLEYLSLVSKVCTELESHTGTGDKVLAEFITELGRSSENVEEFDATLK
ENGAEMPDYFVRTLLTIIHAILPPNKSKKSDAKKESSAPTTNTKFKALAIADDRDRVKEL
QKEIENETEAARQKGRERGEEEYGYGDRDNRDRRRDRYEREDRHRSRDRERDVDEDDRRD
DYRRRGRDRDRDRDRDVGEDERRDDYRRRGRGRDKDRGRDRYGRDERDGYEENERGRENG
DENGDRKGRRDSRHGGGGSSEPDLYQVYKGRVSRVMDTGCFVQLDDFRGKEGLVHVSQIA
TRRITNAKDVVKRDLEVYVKVISVSGQKLSLSMRDVDQHTGKDLLPLKKSSEDDVSRMNP
QDSKDGPVARTGLSGIRIVEEDDLGKSRRPLKRMSSPEIWEAKQLIASGVMSVSEYPTYD
EEGDGMLYQEEGAEEELEIEMNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGRAAALQS
ALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYDMPEWKK
DAYGKTITFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQY
LAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYM
TDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPEMRLIVTSATLD
AEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLT
GQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNI
AEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYR
LYTESAYRNEMSPTSIPEIQRINLGTTTLNMKAMGINDLLSFDFMDPPSPQALISAMEQL
YSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRP
REKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQ
LLTIMDKYKLDVVSAGKNFTKIRKAITAGFFFHASRKDPQEGYRTLVENQPVYIHPSSAL
FQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPL
YDRYHEPNSWRLSKRRA
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggataatttagatgaaggattgaagaagaagctcgaatacttgtcccttgta
tcaaaggtttgcaccgagttggaatctcacaccggcaccggcgacaaggtcctcgccgag
ttcataaccgagttaggtcggtcatcggaaaacgtcgaagaattcgatgcgactctgaaa
gagaacggtgctgaaatgcctgattacttcgtccgaacgcttctcaccataattcacgcc
atccttcctcccaacaagtccaagaagtcagatgctaagaaagagagttcggcgccgacg
actaatacaaagtttaaggctctggccattgctgatgatagggaccgtgtaaaggagctt
cagaaggaaatcgaaaacgaaacagaagctgcgcgacagaaagggagagaacgaggagaa
gaggaatatggttatggagatagagataatagagataggcgcagagacaggtatgaaaga
gaggatagacatagaagtagggatagagaaagagatgttgatgaagatgatagaagggat
gattataggagaaggggaagggacagggatagggatagggatagagatgttggtgaagat
gaaagaagggatgattacaggagaaggggaaggggtagagataaggataggggcagggat
agatatggcagagatgaaagagatggctatgaagaaaatgaacgaggaagggagaacggt
gatgagaatggtgataggaaaggtcgaagagattcgaggcatgggggtggtggttctagt
gaacctgacttgtatcaggtttataaagggagagtgtcaagggtgatggatactgggtgt
tttgttcagcttgatgattttagagggaaagagggcttggtgcatgtttctcagattgcg
actcggaggattactaatgctaaggatgtggtgaagcgggatctggaggtttatgtgaag
gtgatatcggtttctggtcagaaattgagtctttcgatgagggatgttgatcagcatact
gggaaggatcttcttccattgaagaagagctcagaggatgatgtttctcggatgaatcca
caggattcgaaggatgggccggttgccaggacgggactttcgggaatcaggattgtggaa
gaggatgatcttggtaaatcgcgtagacctttgaagaggatgagctctccggagatatgg
gaagcaaaacagttgattgcttctggtgttatgagtgtttcggagtacccgacttatgat
gaggaaggagatggaatgctgtaccaagaggaaggtgctgaggaagagcttgagattgag
atgaatgaggatgaacctgcctttttgcaagggcagagtagatattccatggatatgtct
cctgttaagatttttaagaatccagaaggttctttgggtcgtgctgctgctctccagtct
gcacttataaaggagcgtagagaggtacgagaacaacaacaacgcacaatgctcgattca
attccaaaggatctcaatcgtccttgggaagaccctatgccagagtctggtgaaaggcat
cttgcccaggagcttaggggcgttggcttatcagcctatgacatgccagaatggaagaag
gatgcttatgggaaaaccattacttttgggcaaagatcaaagctttctatccaggaacag
aggcagagtttaccaatttacaagttgaaaaaagaattgattcaggcagtccatgataat
caggtgttggtggtcattggtgaaacgggttcgggcaagactactcaggtcacgcagtat
ctcgctgaagctggttacacaacaagaggtaaaattggatgtactcaaccacgtagggtg
gctgcaatgtcggttgcgaagagagtggctgaagagttcggttgtcggttgggagaggaa
gttggttatgccattcgatttgaggattgcactggaccggatactgtaatcaagtacatg
acagatggtatgcttctgagagaaatattggttgatgaaaatctgtcacagtattctgtt
ataatgcttgatgaggcccacgaaagaactattcataccgatgttctgtttgggctgctg
aagcagctagtgaagcgtagacctgaaatgcgattgattgtgacttctgctactctggat
gctgagaaattctcaggatatttctttaactgtaacatttttacaattcctgggaggact
tttccggtggagattctttatactaaacaaccagaaagtgattacttagatgcatcttta
atcactgtcctacagatccacttgacagaacctgaaggagacattcttctcttcttgact
ggtcaagaggagattgattttgcttgccagtctctctatgagagaatgaaggggttaggt
aagaatgttcctgagttgatcattttgcctgtttatagtgcccttcctagtgaaatgcaa
tcgaggatatttgaccctgctcctcctgggaagaggaaggtggttgtggccactaacatc
gctgaggcttctttgactattgatggaatattttatgtgattgatcctggattcgccaag
caaaatgtttataatccaaagcaaggtcttgattctttggtgataactccaatttcacaa
gcatcagccaaacaaagagctggacgtgcagggcgtaccggacctgggaaatgttatcgc
ctctatactgagagtgcatataggaatgagatgtctcctacttcgattccggagattcaa
aggataaatctcgggacaactactcttaatatgaaagctatggggataaatgatcttctg
tcttttgattttatggacccaccgtcacctcaagctcttatttctgccatggaacaactt
tacagtcttggagcattggatgaagagggccttttaaccaagttggggaggaaaatggca
gaatttcctctggatccaccattgtccaagatgctgcttgccagtgtggaccttggatgc
agtgacgagattttgactataattgccatgattcagactggcaatatattttacaggcct
agggaaaaacaagcccaagcagatcagaaaagggcaaagtttttccagcctgagggtgac
catctcacactgcttgctgtttatgaggcttggaaagctaagaatttttctgggccctgg
tgttttgagaactttgttcaatctcgatcgttgagaagagcacaggatgtcaggaaacag
cttctgaccatcatggataagtataaattggatgttgtaagtgcgggtaaaaacttcacc
aagatcaggaaggctatcactgcaggattctttttccatgcatcaagaaaggaccctcag
gaaggttacagaaccctagttgaaaaccagcctgtatacatccatccaagttctgctttg
ttccagagacagccagactgggtcatctatcatgagcttgttatgactactaaggaatac
atgcgtgaggtcactgtcatagaccccaaatggcttgttgaattggctcctagattcttc
aaagtggcagatcctacaaagatgagcaagcgaaagcgtcaagagcgtatagaaccactt
tatgatagataccacgagccaaactcatggcgtttgagtaaacgtcgtgcatga

DBGET integrated database retrieval system