KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109343632Help
Entry
109343632         CDS       T04664                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00010  Glycolysis / Gluconeogenesis
lang00562  Inositol phosphate metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109343632
   00562 Inositol phosphate metabolism
    109343632
Enzymes [BR:lang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109343632
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109343632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109343632
NCBI-ProteinID: XP_019437568
Position
LG03
AA seq 509 aa AA seqDB search
MKKNVMSFLVFLITLLLLFFFSFSISEQHQQNEAFNVRQHLSTVTRYGAVKHIAHNHFIP
SNIPQGCVPIHLNLVARHGTRSPTKKRIKQLDNFSAHLQVLISDAKERNLPMERIPSWLH
GWKSPWQGWLKGGELTSKGEEELYELGIRIRERFPNLFEEEYHPDIYPIRTTQVPRASAS
AVAFGMGLFSNNGSLGPGHHRAFAVTSESRASDIVLRFHDCCHNYKDFRKRKGPAVDKLK
EPILDEITATLVGRYGLNFTRQDTSSLWFLCKQEASLLDITNQACSLFSPSELTLLEWTD
DLEVFILKGYGNSLNYRMGIPLLEDVVLSMEQAIKAEEERRPPGTFEKARLRFAHAETVV
PFSCLLGLFLEKSEFEKIQKEQPLQLPPKPRQKRKWQASTVAPFAGNNMLILYSCPANDK
STSKHFVQVLHNEHPIPMLGCNGSDFCPFEVFKEKIVAPHKKHDYDTVCNAKLERNRTGG
KFSEIFQWLLSLGKGDKFSLVYHITNFQT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaatgttatgtcttttcttgttttcctaataacattattattattattcttt
ttctctttttcaatctccgaacaacatcaacaaaacgaagctttcaatgttcgccaacat
ctctctactgttaccagatatggtgctgtcaaacacattgctcataatcattttattcct
tccaatattcctcaaggatgtgttccaattcatttaaatcttgtggcaaggcatggaact
cgttctcctacaaagaaaaggataaagcaattagataatttttcggctcatctacaagtt
cttataagtgatgcaaaagagcgaaacttgcctatggagagaattccttcctggctacat
ggatggaaatctccatggcaaggatggcttaagggcggtgagttaactagcaaaggagag
gaagagttatatgagctcggaatcaggatcagagaaaggtttccaaatttgtttgaagaa
gaataccatccagacatatatcctataaggacaactcaggttccacgagcatcagctagt
gcggtggcatttggaatgggacttttcagcaacaatggaagtcttggacctgggcatcat
cgagcttttgctgttacaagtgaaagccgtgctagtgacatcgtgcttagatttcatgat
tgttgtcataactacaaggactttaggaaaaggaagggacctgcagttgataaacttaag
gaacctatcttggatgagattacagcaacattagttgggcgatatgggttaaattttaca
aggcaggatacatcttctctctggtttttgtgtaaacaggaagcatccttattggatata
actaatcaagcatgtagtcttttcagcccttctgagcttacattgctggagtggacagat
gacttggaggtgtttattctgaagggttatggtaattcattaaactacagaatgggaata
ccattacttgaagatgttgttctatccatggaacaagctattaaggctgaagaagaaaga
cgtcctcctggtaccttcgaaaaggcaagacttcgtttcgcacatgctgaaactgtagtt
ccgttctcatgtctccttggtttatttcttgagaaatctgagtttgaaaaaattcagaag
gagcaacctttgcagctccctccaaagcctcgtcagaaacgaaaatggcaggctagcacc
gtagccccctttgctggtaacaacatgctgatcttgtatagttgtccagcaaatgacaaa
tctacaagcaagcattttgtgcaggtgctgcacaatgaacaccccattccaatgctgggt
tgtaatggttctgatttctgtccatttgaagtattcaaggaaaaaattgttgcacctcac
aagaagcatgactatgatacagtctgtaatgcaaagctagagcgaaatcggacgggcggc
aagttttctgaaatatttcagtggcttttgtcattagggaaaggtgataagttttctttg
gtgtaccacataacaaattttcagacatga

DBGET integrated database retrieval system