KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109344998Help
Entry
109344998         CDS       T04664                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00520  Amino sugar and nucleotide sugar metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109344998
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     109344998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 109344998
NCBI-ProteinID: XP_019439288
Position
LG04
AA seq 443 aa AA seqDB search
MNTSFDSSELIHRQTRKHIQHNEPHYSSPSPTSPPKQTTNKIITNIPFILIGLTISSLFF
YTFPLTKPYPTTHYPESSSSSSSLFSLPTRRILLEEPTTNTGGSGSGGGGGGIMTRVPGG
VRGKRKRVVVTGGAGFVGSHLVDRLIERGDSVIVVDNMFTGRKDNLLHHIGNPNFELIRH
DVVQPILLEVDQIYHLACPASPVYYKFNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTS
EVYGDPLQHPQAETYWGHVNPIGVRSCYDEGKRTAETLAMDYHRGAGIEVRIARIFNTYG
PRMCLDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHIGPFNL
GNPGEFTMLELAQVVQETIDPNAKIEYRPNTEDDPHKRKPDISKAKELLGWQPTVSLREG
LPRMVADFRQRLSGESKGSVSAA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttctttcgactcctccgaactcattcatagacaaacccgaaaacatattcaa
cataatgaaccacattattcttctccttctccaacttctcctccaaaacaaacaacaaac
aaaatcatcaccaacattcccttcatcctcattggtctcaccatttcctctctcttcttc
tacactttccctctaaccaagccatacccaacaacacactaccccgagtcatcgtcgtca
tcatcatcattattctctctcccaactcgacgaatccttctagaagaacctacaaccaac
acaggtggtagtggtagtggtggtggtggtggtggtataatgacacgtgtacccggcggt
gtacgtgggaaaaggaagagggtagtggtaactggtggagctggctttgtagggagccat
ttggtggataggttgattgagagaggtgacagtgtgattgttgttgataatatgtttaca
ggaaggaaagataatttgttgcatcacattggtaatcctaactttgaactcattagacat
gatgttgttcaacctattctcttagaggttgatcagatttaccatcttgcttgtcctgct
tctcctgtttattacaagttcaaccctgtcaagaccattaagaccaatgttatgggcaca
ctcaacatgttgggactggcaaaaagggttggtgctcgttttctgcttaccagcaccagt
gaggtgtatggtgatcctcttcaacaccctcaagctgagacatactggggccacgttaac
ccaattggtgtaagaagctgttatgatgaggggaaacgtactgcagagaccttggccatg
gactatcacagaggtgctggtattgaggtgaggattgctcgtatcttcaacacttatgga
ccaagaatgtgccttgatgatggccgtgtagttagcaacttcgttgctcaggcattgagg
aaggaaccattgacagtttatggcgatgggaaacaaacaagaagctttcaatatgtttca
gacctggtagaaggcctaatgaggttgatggaaggcgagcatattggtcctttcaatctt
ggcaaccctggtgaattcaccatgcttgaacttgctcaggtggtgcaagagactatagac
ccaaatgcaaagattgagtataggcctaacacagaggatgacccacataagaggaagcct
gacatttccaaagctaaggagcttctcggctggcagccaactgtgtccctccgcgaggga
cttcctcgaatggtcgccgacttcaggcaaaggctatctggtgagtcaaagggcagtgtt
tctgcagcatag

DBGET integrated database retrieval system