KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109347628Help
Entry
109347628         CDS       T04664                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00052  Galactose metabolism
lang00500  Starch and sucrose metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109347628
   00500 Starch and sucrose metabolism
    109347628
Enzymes [BR:lang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109347628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 109347628
NCBI-ProteinID: XP_019443111
Position
LG05
AA seq 574 aa AA seqDB search
MMKIFAALNLLGLFFSLLNRIESFQHSMSSINMVNQNQPYRTSYHFQPQQNWMNDPNGPM
YYKGVYHLFYQHNPEAATFGDRIVWGHSVSYDLINWIHLNHAIEPSEPYDINSCWSGSAT
ILQGEKPAILYTGIDENKHQVQNFALPKDLSDPFLREWVKHPQNPVMTAPSGVEVDNFRD
PSTAWKGGDGKWRVVIGAQNGDEGKVILYQSDDFVNWTVHPNPFYASDNTRVCECPDFFP
VSINSTNGLDTSIQNASVRHVLKISYLSKQHDYYFLGKYVSDQENFIPDIKFTGTSSDLR
FDYGKFYASKSFFDYAKNRRILWGWVNESDTSQDDIEKGWAGLQTIPRQVWLDKSGKQLI
QWPIEEVEKLHDKQITITGEKLVSGSTLEVSGITASQVDVDVLFEIPELESAEWLDPSGV
DPQLLCSQGHASISGTIGPFGLLALAAKDLTEQTAVYFRIYKAPNRYIGLMCSDQSRSSL
RQDLDKTIYGTFFDIDPNVKTISLRSLIDHSIIESFGEKGRVCITSRVYPSLAIDKEAHL
YVFNNGIKNVVISKLNAWSMKQALLGNEGNNSSA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagatctttgcagcactaaacttacttgggttatttttttctttgttaaacaga
attgaatcatttcaacatagcatgagttctatcaatatggtaaatcaaaatcagccttat
agaacttcctatcactttcagccccaacaaaattggatgaatgatccaaatggaccaatg
tactataaaggtgtttaccaccttttctaccaacataatcctgaggctgcaacctttgga
gacaggattgtatggggtcattctgtatcatatgatctcatcaattggattcatttgaat
catgcaattgaaccaagtgagccatatgacatcaatagttgttggtcgggctcagccaca
atactccaaggcgaaaagccggctattttgtatacaggtattgatgagaacaagcatcaa
gttcagaactttgctttgccaaaggatctatcagatcctttcttaagggaatgggtcaaa
caccctcaaaaccctgttatgactgcacctagtggagttgaagtggataattttcgagac
ccttcaactgcttggaagggaggggatggaaaatggagggtagtcattggtgctcaaaat
ggtgatgaagggaaagtaattctctaccaaagtgatgatttcgttaattggacagttcat
ccaaatcctttttatgcatcggataatacccgagtttgcgaatgcccagacttttttcca
gtgtccatcaatagcaccaatgggttggatacatctatccaaaatgcaagtgttaggcat
gtcttgaagataagttatctaagcaaacagcatgactactattttcttggcaaatatgtt
tctgatcaggaaaactttattcctgatattaagtttacaggaactagttcagatttgaga
tttgactatggtaagttttatgcttccaagtcattttttgactatgccaagaacagaagg
atattgtggggatgggtgaatgaatctgacacctcacaagatgatattgagaaaggatgg
gctggtttacagacgattccaaggcaagtttggcttgataaaagtgggaagcaattgatc
caatggccaattgaagaggtagaaaaactacacgacaagcaaatcactatcacaggagag
aaactcgtcagcggatcaactcttgaagtttcaggcatcactgcatcgcaggttgatgta
gatgtgttgtttgagatacctgaactagaaagtgctgagtggttagatccaagtggagtt
gatcctcaactactatgtagccaaggacatgcatcaataagtggcacaataggacctttt
ggtttgttagctttggctgcaaaggatctaacagagcaaactgcagtgtacttcagaata
tacaaagctcctaacagatacattggcctaatgtgcagtgaccagagcaggtcttcattg
aggcaggaccttgataaaactatatatggaactttctttgacatagatcccaatgtgaaa
acaatttcacttagaagcttgattgaccactcaattattgagagttttggagagaaggga
agagtttgtatcacgagtagagtttatccctccttagctatagacaaagaggctcacctt
tatgtatttaacaatggaattaagaatgtggtgatctcaaaattgaatgcttggagcatg
aagcaagcactgcttggaaatgagggaaataatagttctgcctaa

DBGET integrated database retrieval system