KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109350031Help
Entry
109350031         CDS       T04664                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00052  Galactose metabolism
lang00500  Starch and sucrose metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109350031
   00500 Starch and sucrose metabolism
    109350031
Enzymes [BR:lang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109350031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 109350031
NCBI-ProteinID: XP_019446688
Position
LG06
AA seq 643 aa AA seqDB search
MSFPSVSDNPHESTSSTPLLNGSHPRKNVKGVLLILCGLLLLVSLISYNGLYRASNIQEE
PSNTKTVPSTMSPVSRGVANGVSEKSNRLFSSNNIGESENYPWNNSMLSWQRTAFHFQPE
KNWMNDPNGPLYYKGWYHFFYQYNPNAAVWGDIVWGHSVSRDLIHWLHLPLAMVNDQWYD
INGVWTGSATILPNGQIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPNNPVLFPP
PGIGYKDFRDPTTAWLTSEGKWRITVGSKLNKTGIALVYDTKDFKTYELKEGTLRAVPGT
GMWECVDFYPVSKLAENGLDTSSNGAGVKHVVKVSLDDDRHDYYSIGNYDEKKISFIPDD
VKNDVGIGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVTKGWASVQSIPRTV
KLDKKTRSNLLQWPVAEVETLRLRSNEFKNLKAKPGSVVSLNIESATQLDIVAEFEINKE
ALEKTTESNVEYQCSTNGGAAKRGALGPFGLLVLADEGLSEYTPVYFYVIKGSDGQLKTS
FCSDQSRSSLATDVNKQIFGSFVPVLTGEKLSVRILVDHSTVESFAQGGRTCIASRVYPT
RAIYGATRLFLFNNATEATVTASIKIWQLNSAFIRPFHSGHKI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttccttctgtgtctgataaccctcatgaatctacttcatccactcctctcctc
aatgggtcccaccctcgcaaaaacgtgaagggggtccttcttatcctttgtggattgttg
ctacttgtttctctgatttcttacaatggcttatacagagcctccaatatacaagaagaa
cctagtaacacaaaaacagttccttcaacaatgagccctgtttcacgaggtgttgctaat
ggggtgtcagaaaagtctaacaggttattctctagcaacaacattggagaatccgaaaac
tatccttggaacaatagcatgttgtcgtggcagagaacagcttttcatttccaaccagag
aaaaactggatgaacgatcctaacggccctttgtactacaagggatggtatcacttcttc
taccagtacaatcccaatgctgcagtttggggagacatagtttgggggcattctgtgtca
agggacttgatccattggcttcaccttccacttgcaatggttaatgatcaatggtatgac
ataaatggtgtttggactggttctgctacaatcttaccaaatggtcaaatcataatgttg
tatactggttcaaccaatgagtcagttcaggtgcagaaccttgcataccctgctgatccc
tctgatcctctccttgtggattggattaaataccctaacaacccagttctcttccctcca
ccaggcattggttacaaggactttcgtgaccccaccactgcatggctcacctctgaagga
aaatggcgcatcaccgtaggatctaagctaaacaaaactggcattgccttagtttatgac
actaaggacttcaagacctatgagcttaaggaaggaacccttcgtgcagttccaggcact
ggcatgtgggagtgtgtggatttttatccagtgtccaagttggctgaaaatggcttagat
acctcatctaatggtgctggggtgaaacatgttgtgaaggttagcttggatgatgataga
catgattactattcaatagggaattatgatgagaagaagattagtttcataccagatgat
gttaagaatgatgttggtattggattgaggtatgattatggtatattctatgcatccaag
acattttatgatcaaagtaagggaagaagagtgttgtggggttggattggagagtctgat
agtgaatatgctgatgttaccaaaggctgggcttcagttcagagtattccaaggacagtg
aagcttgataagaagactagaagcaacttacttcagtggcctgttgctgaggttgagact
ttgagattgagaagcaatgaatttaaaaatttgaaggcaaagccaggttcagtggtgtca
ctaaatattgaatcagccacacagttggacattgttgctgagtttgagataaataaggaa
gcccttgagaaaaccaccgagtccaatgtggagtaccagtgcagcaccaatggtggagct
gcaaaacgtggtgcattgggaccttttggtcttttggttttggcagatgagggactttct
gaatatactcctgtgtacttttatgtcattaaaggaagtgatggtcaacttaagacttca
ttctgttctgatcaatcaaggtcttctctagccactgatgttaacaaacaaatctttgga
agctttgttccagtgcttacaggcgaaaagttgtctgtaaggatactggtggaccattct
acagttgaaagctttgctcaaggtggaaggacttgtatagcatctcgagtttacccaaca
agggcaatctatggagcaacacgattgttcttgttcaacaatgctactgaggccacagtc
acagcctcaatcaagatttggcagttgaattctgcatttatacgcccattccactctggt
cataagatttaa

DBGET integrated database retrieval system