KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109350830Help
Entry
109350830         CDS       T04664                                 

Definition
(RefSeq) non-specific phospholipase C2-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00562  Inositol phosphate metabolism
lang00564  Glycerophospholipid metabolism
lang00565  Ether lipid metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109350830
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109350830
   00565 Ether lipid metabolism
    109350830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:lang02042]
    109350830
Enzymes [BR:lang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     109350830
Bacterial toxins [BR:lang02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   109350830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 109350830
NCBI-ProteinID: XP_019447683
UniProt: A0A1J7I6Q7
Position
LG06
AA seq 518 aa AA seqDB search
MSYRFSFFFFTFLLLHSSTTSNAIENNIKTVVVLVMENRSFDHMLGWMKKLNPNINGVTG
SEFNLLSVDDPKSRRFMFKDKVEYVDPNPGHKFDAIREQIFGSKTAFVDPAPMNGFAQQA
HSIDSSNKMSENVMNGFTPNKVAVYKTLVSEFALFDRWFSSVPTSTQPNRLYVHSATSHG
ATSNAALHLVKGYPQRTIFDNLHQAGKSFGIYFQNAPTTLFYRSLRKLKYLTKFHQYHLS
FKKHARQGKLPNYVVIEPSYFDTKILPGNDDHPSHDVYRGQMLVKEVYQTLRASPQWNQT
LLLITYDEHGGFYDHVPTPLRGVPSPDGIQSSENFNFDRLGVRVPTIAVSPWIEKGTLVH
GAKGPTPTSEYEHSSIPATVKKIFNLPNFLNKRDEWAGTFESILQTRKEPRTDCPRYLPT
PVKIRKSEADEEASLSEFQQELIQLGAVLKGDNVLTSYPHTVGNDMNVKQGKEYLEDSVK
RFFEAGHFAKKMQVSEEHIVQMKPSLTSRPSNSPITDP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagttataggttctcatttttcttcttcacctttctacttctccattcttcaactact
agcaatgccattgagaataacattaaaacggtcgtcgttttagtgatggagaatcgttcc
ttcgaccacatgttgggatggatgaagaaactcaacccaaacatcaacggtgtaacaggc
tcggagttcaacctgttatctgtagacgacccgaaatcaaggcggttcatgttcaaagat
aaggtagaatatgttgacccgaatccgggtcacaaatttgacgccataagggaacaaata
ttcgggtcgaaaaccgctttcgttgatccagcaccaatgaacgggtttgcccaacaagca
cattcaatagattcatccaacaaaatgtctgagaatgttatgaatggatttactcctaat
aaggttgctgtttataagacacttgtctctgagtttgctctctttgataggtggttttct
tcggtaccaacttccactcaacccaaccggttatatgtgcactcagcaacttcccacggc
gccaccagcaacgcggcgttgcaccttgtaaagggctacccacaacgtacaatcttcgac
aacctccatcaagctggaaaaagcttcggaatatacttccagaatgcaccaacaacatta
ttctataggagcttaaggaagttgaagtacttgactaaatttcatcaataccacttgtcg
tttaaaaaacatgcaaggcaagggaagttgccaaattatgttgtgatagaaccgagttac
tttgacacaaagattctaccaggaaatgatgatcacccttcgcatgatgtgtaccgaggg
caaatgttggtgaaggaagtgtatcagacactgagggcgagcccacaatggaaccaaacc
ttgttattgataacgtacgatgaacatggtgggttctatgatcatgttcctactcctctt
cgtggagtaccaagcccagatgggattcaaagttctgaaaacttcaactttgataggttg
ggagtgagggttcctaccattgccgtctcaccttggattgaaaaaggcactcttgttcat
ggagcaaaaggaccaacaccaacttcagaatatgaacactcatccattccagcaacagtg
aaaaagatcttcaatttgcctaattttctgaacaagagagatgaatgggctggcaccttt
gagagtattctccagaccaggaaagaacccagaactgattgcccaaggtatctcccaacc
ccagtaaagatcaggaagagtgaggctgatgaagaagcaagcctcagtgaatttcagcag
gagttgattcagctaggtgcagtgcttaaaggagataatgtcctcactagttacccacat
acagtagggaatgatatgaatgtgaagcaagggaaagagtacttggaagactcagttaag
aggttttttgaagcagggcattttgcaaagaagatgcaagtgagtgaagaacatatagtt
cagatgaagccttctttgacttcaagaccatcaaattcaccaataacagacccatag

DBGET integrated database retrieval system