KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109354735
Entry
109354735         CDS       T04664                                 

Definition
(RefSeq) phenolic glucoside malonyltransferase 1-like
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00943  Isoflavonoid biosynthesis
lang00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    109354735
   00943 Isoflavonoid biosynthesis
    109354735
Enzymes [BR:lang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     109354735
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 109354735
NCBI-ProteinID: XP_019452975
UniProt: A0A1J7HVV1
Position
LG08
AA seq 453 aa
MAHSTSLNLHQLHSVAPPHATTATTFPLTFFDILWLRLPPVERLFFYEFPTTSKTTSFYD
IIVPNLKHSLSLTLQHFIPLVGNITWPLESSNPIINYVPGDAVSFTVAESNSDNFNHLCS
NLCDVVDRQHLIPRLNISHEQASVLSLQVTLFPNSGFCIGITTHHAAVDGKSSTMFLKTW
AYFCSKIQEQLTQIPSSLPENQTPFLDRSVINDPSGITEAFVDSWLNYDGPNNRSLKVWD
TISAVKTEQVKGLFELTPSHIQKLKKHALSKVKTKVSTFSVTCAYLLSCLAKVEKPKDER
VAFIFSVDCRTRLDSPILATYFGNCVFPQLVVVETNKLVENDGFIIALEGIIDALNKLED
GVLNEGEKWMSKIQSAIGNRLFSTAGSPRFEVYGIDFGWGRPKKVDVTSIDKTGAFSLSE
SKNNDGGVEVGLALNKVEMEAFLALFHQQLESF
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcacactctacatctctcaatcttcaccaactccactcggtggcgccgcctcatgca
accaccgcaaccaccttccccctcaccttctttgacattctttggctgagactccctcca
gttgaacgtcttttcttctatgaattcccaacaacatcaaaaaccacttcattctatgat
atcattgttccaaatctgaaacactctctttcactcactctccaacacttcattcccctt
gttggtaacataacttggcctcttgaatcatcaaaccctatcatcaactatgtccctggt
gatgctgtttctttcactgttgctgaatccaactcagataatttcaaccatctttgttct
aatctatgtgatgttgtggatcgtcaacacttaatacctcggttgaatatttctcatgaa
caagcttcagttttatctcttcaagttactctctttccaaattctggcttttgtattgga
ataacaacacatcatgcagcagttgatggaaaatcttccaccatgttcttgaaaacatgg
gcatatttttgctctaagattcaagaacagttaacacagattccatcttcattacctgaa
aatcaaacaccctttttagatagatcagtgataaatgacccttcaggaatcactgaagca
tttgtggatagttggttgaattatgatggcccaaataatcgaagcctcaaagtttgggat
acaattagtgcagtgaagactgaacaagtgaaaggtttgtttgaactaacaccttcacat
atccaaaagcttaagaaacatgcactatctaaggtgaaaactaaggtatcaactttttct
gtaacatgtgcttatttgttatcatgtttagcaaaagtagaaaaaccaaaggatgaaaga
gtagcttttatattcagtgtggattgtagaacccgtttggattctccaattttagcaaca
tattttggaaactgtgtttttccacaactagttgtggttgagaccaataagttagtagaa
aatgatggattcattattgcactagaaggtataattgatgctttgaataagttagaagat
ggggtgttgaatgaaggagaaaaatggatgtcaaagatacaatctgcaatagggaataga
ttattttctactgctggatcaccaaggtttgaggtttatggaattgattttggatgggga
aggcctaaaaaagttgatgttacttctattgataaaactggagctttttctctttcagaa
agtaagaataatgatggtggagttgaggttggtttggctttgaacaaggttgagatggaa
gcttttcttgctctttttcatcaacaacttgaatctttttaa

DBGET integrated database retrieval system