KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109355561Help
Entry
109355561         CDS       T04664                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00450  Selenocompound metabolism
lang00970  Aminoacyl-tRNA biosynthesis
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109355561
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109355561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lang01007]
    109355561
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lang03016]
    109355561
Enzymes [BR:lang01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109355561
Amino acid related enzymes [BR:lang01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109355561
Transfer RNA biogenesis [BR:lang03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109355561
 Prokaryotic type
   Other AARSs
    109355561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 109355561
NCBI-ProteinID: XP_019454325
UniProt: A0A4P1R9A9
Position
LG08
AA seq 801 aa AA seqDB search
MTEENPKLTKLPIEGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIY
ICGTDEYGTATETKALEENCSPKQICDKYHAIHKEVYNWFNISFDEFGRTSSPQQTEVCQ
AIFKRLYDNKWLSENTMQQLYCDTCEKFLADRLVEGDCPTPGCEYDSARGDQCEKCGKLL
NPTELKNPRCKVCRKSPRIRDTDHLFLELPLLKDRLEKYINEMSVVGLWSQNAIQTTNSW
LREGLKQRCITRDLKWGVPVPHEKYSDKVFYVWFDAPIGYVSITSCYTPEWEKWWKNPEN
VELYQFMGKDNVPFHTVMFPSTLLGTHENWTLMKTISVTEYLNYEAGKFSKSKGVGVFGN
DAKDTGIPVEVWRYYLLTNRPEVSDTLFTWSDLQAKLNSELLNNLGNFINRVLSFIAKPA
GQGYDSIIPAIPDDVSDDSHELTKKLANEVSANLEQYIDAMEKVKLKQGLKIAMSISSEG
NRYLQEAEFWHLYKDNKSLCSLVMKTAVGIVYLLACLLEPFIPSFTLEVFKQLNLSPETH
LSLCDEKGDIDRVKRPWDIISAGHKIGKPQPLFRELKDEEVEFYREKFAGSQADRIVRAE
AEKVAEQLKKTKVSDGSGKKKSSAKSSKEAKNKAVAEPDISITRLDIRVGLIKKAEKHPA
ADTLYVEEIDVGEEQPRTVVSGLVNYIPLDEMQNRKVCVLCNLKPVTMRGIKSHAMVLAA
SNDSKVELVEPPTDARVGERVTFPGYEGNPDEILNPKKKVWETLQVDLHSNDELVACYKD
VPLTTSAGICKVSSIPGGSIK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggagaatccaaaactgacaaagcttccgatagaaggaaagcgcaacatcctc
atcaccagcgctttgccttacgtcaataacgttcctcatctcggcaacatcattggatgt
gtgttgagtgctgatgtatttgctcgatattgtcgtcttcgcggttacaacgctatttat
atttgcggtaccgatgagtatggaactgcaactgagactaaagcgttggaagagaattgc
tctcctaaacagatttgtgacaaatatcacgctattcataaggaggtctacaattggttc
aatatcagttttgatgaatttggccgcacgtcatcccctcagcaaactgaagtctgtcaa
gcaatttttaaaagactatatgataacaagtggctttccgagaacacaatgcagcagctt
tactgtgatacttgcgaaaagttcttagccgatcgacttgtggagggtgattgcccaact
ccaggatgtgagtatgactccgcccgaggagaccagtgtgaaaaatgtggaaaactacta
aatcctactgagttgaaaaatcctaggtgcaaggtttgtcgaaaaagtccacgtattcgt
gatacagaccacttgtttcttgaactccccctattgaaagatagattggaaaaatacatc
aatgagatgtcagtggtgggattatggagtcagaatgccatccaaacaacgaattcatgg
ttaagagaagggttgaaacaacgctgcattactagagatttaaagtggggggttcctgtc
ccccatgaaaaatatagtgacaaggttttctatgtttggtttgatgctccgattggttat
gtttcgatcacttcatgctacacacctgaatgggagaaatggtggaaaaacccggagaat
gtggagttgtatcagtttatgggcaaggacaatgtgccattccacactgtcatgttccca
tctactttacttggaactcatgaaaactggactttgatgaagactattagtgttaccgaa
tacttgaattatgaagcagggaagttttctaaaagcaaaggcgtcggagtatttggtaat
gatgcaaaagacactggtattccagttgaagtatggagatattacttgctcacaaatagg
cccgaggtatctgatacgttatttacttggtctgacttgcaagcaaaattaaatagtgag
ctgctgaataatctgggcaacttcatcaaccgagttttaagttttattgccaaacctgca
ggtcaaggatatgattccattattcctgctattcctgatgatgtaagtgatgactctcac
gaactgaccaaaaaattggcaaatgaagtttctgcaaatctggagcaatacatagatgca
atggagaaggttaaactaaaacaaggattgaaaattgcaatgagcatatccagtgagggc
aatagatatctgcaggaagctgaattttggcacctttacaaagacaacaaatctctatgc
tcccttgtaatgaaaactgcagttgggattgtgtatcttctcgcatgtttattggaacct
tttattccatctttcactcttgaggtatttaagcagcttaatttgtccccggagacacat
ctttcactttgtgatgaaaagggagatattgatagggtgaaaagaccttgggatatcata
agtgctggtcataaaattgggaaaccccagccattgttcagagaactgaaagatgaagaa
gtggagttctacagggagaaatttgcaggaagccaagctgataggattgtgcgtgcagag
gctgaaaaggttgctgagcaactgaagaaaacaaaagtctcagacggaagtggaaagaaa
aaatcatcagctaagtcatcgaaagaagccaaaaataaggcagttgctgaacctgatatt
tccatcacgaggcttgatattcgtgttggccttataaaaaaagctgaaaaacatcctgct
gcagatactctatatgttgaggagatagatgttggtgaagaacagcccagaacggtcgtg
agtgggcttgtgaactacataccacttgatgaaatgcagaaccgtaaggtctgtgttctt
tgtaacctaaaaccagtgaccatgaggggaattaaatctcacgcaatggtgcttgctgct
tcgaatgactcaaaggttgaattggttgagccacccactgatgctcgcgtcggagaaaga
gttacattcccagggtatgaaggtaatcctgatgaaatcttaaacccaaagaagaaagtt
tgggaaacattgcaagtagacctgcacagtaatgatgaactagtggcatgctacaaagat
gttccactcaccacatcagctggcatttgcaaggtttcatccatacctggtggatccatt
aagtaa

DBGET integrated database retrieval system