KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109355975Help
Entry
109355975         CDS       T04664                                 

Definition
(RefSeq) probable protein S-acyltransferase 1
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
Enzymes [BR:lang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109355975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 109355975
NCBI-ProteinID: XP_019454825
Position
LG09
AA seq 417 aa AA seqDB search
MSTNSSNRNLVSPSSSVVVSMEHSNPKTRRLYQVWKGNNKFLFGGRLVFGQDASSLFLTT
LLIGGPAIMFCIRTLVKIEEQDPFFNHCVLIGGAVLTTLNFIFLFMTSSRDPGIVPRNSQ
LPESEALDISISSMEWIHNKTPNMKLPRMKDVIVNGHSVKVKFCDTCLLYRPPRASHCSI
CNNCVQKFDHHCPWVGQCIGARNYPFFILFISSATLLCIYVFAFSWVNLLRQKGRLWSSM
SHDIVSVALIVYCFIAVWFVGGLTVFHLYLISTNQTTYENFRYRYDKKQNPYTKGIMANF
RELSCFKIPSPLINFRSLVTEEDDFQDGSFTSDLEKGFIHSSHKFDMDKGTMYGKDGSRV
PSVVHDLDYNGVEDHLKRKAGSKEAGFEIFVNSDQDHKYSQWKSKTGIDSPLDERNQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccaatagcagtaaccgtaatcttgtctctccttcctcttctgtggtcgtgtct
atggaacattccaatcccaaaacaagaaggctctaccaagtttggaaaggaaacaataaa
tttctatttggtggaagattagtctttggtcaggatgcatcatctctttttttaacaaca
ctcctaatcggaggtcctgcaataatgttctgtatacgaacgctagtaaaaatcgaagag
caagatcctttctttaaccattgtgtactgattggaggagcagttctcacaactttgaat
tttatttttctcttcatgacatcaagtagagatcccggaattgtccccagaaattcgcaa
cttcctgaatcagaagcacttgatattagtatttcatctatggagtggatacacaataaa
acccctaacatgaaactacctagaatgaaggatgtaatagttaatggacatagcgtgaag
gtgaagttctgtgatacttgcttgctctatcgccccccgcgcgcttcgcattgctctatc
tgcaataactgtgtgcagaagtttgatcatcattgcccttgggttggtcaatgtattgga
gcacgtaactatccattcttcatattatttatatcatcagcaaccttgttgtgtatatat
gtgtttgcattttcttgggttaaccttcttcgccaaaagggtagattgtggtccagcatg
tcacatgatatcgtatccgttgctctcattgtatattgcttcattgctgtttggtttgtg
ggtggcctaacagttttccatctttatttgatttccaccaaccagacaacttatgagaat
ttccggtatcgttatgataagaagcaaaatccatatacaaagggaataatggccaacttt
agagaactttcatgtttcaagatcccaagtccattgatcaatttcagatctttggttaca
gaagaggatgattttcaagatgggtcctttacttcagaccttgaaaaaggttttatacac
tcatcacataaatttgacatggataagggaactatgtatggcaaggatggttcgcgagtt
ccaagtgttgtacacgatttggattataatggcgtcgaagatcatctgaagaggaaggca
ggatcaaaagaagccgggtttgagattttcgttaattctgatcaagatcataaatattct
caatggaaatccaaaactggaatcgatagtcctctagatgagaggaaccaatag

DBGET integrated database retrieval system