KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109357798Help
Entry
109357798         CDS       T04664                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:lang00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    109357798
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lang04131]
    109357798
   03029 Mitochondrial biogenesis [BR:lang03029]
    109357798
Membrane trafficking [BR:lang04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109357798
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109357798
Mitochondrial biogenesis [BR:lang03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109357798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 ATG16 Nup160 PQQ_2 eIF2A Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 109357798
NCBI-ProteinID: XP_019457397
UniProt: A0A4P1RU78
Position
LG01
AA seq 514 aa AA seqDB search
MAKASMSHEEIANEAIKHALKALKKRHLLEEAAHAPAFEALSRPFISQGSEWKEKAENLQ
VELQQCYKVQSRLSEQLVVEVADSRVSKALVQEKETAIADMQKELTEVREESSQLNLDLE
QKIKELEVVVSENSELKAQLGKMTSIAKNAEAENKMLTDRWMLEKMKDAERLNEANALYE
DMIQRLRASGLEQLAKQQVDGIVRRSEEGAELFLESNIPSTCKYRLNAHEGGCAAISFEY
NSSRLITGGQDRLVKVWDTNTGTLSSNLRGCLGSVLDLIITHDNRSVIAASSSNNLYVWD
LSSGRVRHTLTGHTDKVCAVDVSKVSSRHVVSASYDRTIKVWDLVKGYCTNTIISYSNCN
ALSFSMDGQTIFSGHVDGNLRLWDIQTGKLLSEVAAHSLAVTSISLSRNGNVVLTSGRDN
LHNLFDVRSLEVCGTLRAAGNRVASNWSRSCISPDDNHVAAGSADGSIYIWSISTGDIVS
TLKEHTSSVLSCRWSGIGKTLASADKNGIVCLWT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcttccatgtcgcatgaagaaatagcgaatgaagctataaagcatgctttg
aaggctctgaagaagcgccatttactcgaagaagctgctcatgctcctgcttttgaagct
ctttctagacccttcatttctcagggctctgagtggaaagagaaagcagagaatctgcaa
gtggagcttcagcaatgctacaaagttcaatctcggctctcagagcaacttgttgtggaa
gtagccgactctagagtttcaaaagctttggttcaagagaaagaaactgcaatagctgat
atgcaaaaagagttgaccgaagtgagggaggagagctctcaattaaatttggacttagaa
caaaagattaaagagctagaagtggtggtgagtgagaattcagaacttaaagctcagctg
gggaagatgacttctatagctaagaatgctgaagctgaaaataagatgttgactgatcgc
tggatgttagaaaagatgaaggatgctgaacgcctcaatgaggcaaacgcactatatgaa
gacatgattcagcggctaagggccagtggtttagaacaacttgcaaagcagcaggtggat
ggcatagttcgccgaagtgaagaaggtgctgaattatttttagagtcaaacatcccctcc
acatgcaaatataggctcaatgcacatgaaggtggttgtgctgccatatcgtttgagtac
aattcaagtagattgattactgggggtcaggatcggttagttaaagtatgggatacaaat
acaggaaccttaagttctaatcttcgtggctgccttggctcggtgttagatctcataatc
acccatgataatagatctgtcattgctgcaagcagctcaaacaacttgtatgtgtgggat
ctcagctcaggccgtgttcgtcatacccttactggccacacagataaagtttgtgctgtt
gatgtcagcaaggtttcaagtcgtcatgttgtgagtgcatcctatgatcgcacgataaaa
gtttgggacttggtgaaaggttactgcactaacacaatcatttcttacagcaactgcaat
gctctttccttcagcatggatgggcagaccatattttctggacatgttgatggtaatctt
cggttgtgggacattcagacagggaagctactgagcgaggttgctgcacattcacttgcc
gtcacatccatatctctttctcgaaatggaaatgttgtattgaccagtggaagggacaat
ctgcacaatttgttcgatgtgcgttccttggaagtttgtggcaccctaagagctgctgga
aacagagtggcttcgaattggagtcgttcctgtattagcccagacgacaatcatgttgct
gccgggtctgctgatgggtcaatttatatttggtcgatttctacaggcgatattgtcagt
acactgaaggagcacacttcttctgtactaagttgtaggtggagtggaattggaaaaacc
ctggcttcagctgacaagaatggaattgtttgcctttggacataa

DBGET integrated database retrieval system