KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109359237Help
Entry
109359237         CDS       T04664                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00020  Citrate cycle (TCA cycle)
lang00640  Propanoate metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109359237
   00640 Propanoate metabolism
    109359237
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lang04147]
    109359237
Enzymes [BR:lang01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109359237
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109359237
Exosome [BR:lang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109359237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 109359237
NCBI-ProteinID: XP_019459370
UniProt: A0A1J7HMP4
Position
LG11
AA seq 421 aa AA seqDB search
MVRGLLKNIASRSLSVAGKWQHHQLRRLNIHEYQGAELMSKYGVNVPKGIAVSSVEEAKN
AINQVFPNENELVIKSQILAGGRGLGTFKSGLKGGVHIVKTDQIEDIAGKMLGQILVTKQ
TGPQGKLVSKVYLCQKLSLVNEMYFAITLDRKTAGPLIIACSKGGTSIEDLAEKFPDMII
KVPIDVFKGITDEDAAKVVDGLAPKGADRNQSIEQVKSLYKLFRDSDCTLLEINPIAETA
DNQLVAADAKLNFDDNAAYRQKEIFALRDTTQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTADDKVKAILVNIFGGIMKC
DVIASGIVNAAKQVDLKVPVVVRLEGTNVDQGKRILKESGLALITAEDLDDAAQKAVKAY
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggattacttaaaaacattgcctctcgctccctctccgtagctggcaaatgg
caacaccaccagctccgccgcctcaacatccacgagtaccagggagctgagttgatgagc
aaatatggagtgaatgttccaaaaggcatagctgtttcctctgttgaagaagccaaaaat
gccatcaatcaagttttccccaatgaaaatgagttggtgattaaaagtcaaattttagct
ggtggacgaggcttggggacttttaaaagcggtctgaagggaggagttcacattgttaag
actgatcagattgaagacatagctgggaagatgcttgggcagatacttgtaaccaaacaa
actggtcctcagggaaaacttgttagcaaggtttacttgtgtcaaaaactgtcacttgtg
aatgagatgtactttgctataactctggatcgtaagactgctggtccactcattattgca
tgcagcaagggaggaaccagcatcgaagacctcgcagagaaattcccagacatgattata
aaggtacctattgatgttttcaaaggaattactgatgaagatgctgcaaaggttgttgat
ggtttggctcctaaaggggcagatagaaatcaatcaattgaacaagtgaaaagtttgtat
aaactttttcgtgattctgactgcactcttttggaaatcaatcccattgcggagactgct
gataaccaattggtggctgctgatgctaagctgaactttgatgataatgctgcatatcgt
caaaaagagatatttgctctccgtgatacgacacaagaggatcctcgagaggtcgcagct
gcaaaggcagatttaaattatattgggttagatggagaaattggctgcatggtgaatgga
gcagggctcgcaatggccacaatggatatcattaaattgcatgggggtactcctgccaat
tttctggatgtaggtgggaatgcctctgagggccaggtggttgaagcatttaaaatattg
actgctgatgacaaagtgaaggcaattttagttaacatttttggtggtataatgaagtgt
gatgttatagcaagtggaatagtgaatgctgcaaagcaggttgacctgaaagtacccgta
gtagtccgtcttgaaggcaccaatgttgatcaaggaaaaagaattttgaaggaaagtggt
ttggcattaataaccgctgaagatttggatgatgctgcacagaaagcagtgaaagcatac
aaatga

DBGET integrated database retrieval system