KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109359355Help
Entry
109359355         CDS       T04664                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00071  Fatty acid degradation
lang00410  beta-Alanine metabolism
lang00592  alpha-Linolenic acid metabolism
lang00640  Propanoate metabolism
lang01040  Biosynthesis of unsaturated fatty acids
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01212  Fatty acid metabolism
lang04146  Peroxisome
Module
lang_M00087  beta-Oxidation
lang_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109359355
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109359355
   00592 alpha-Linolenic acid metabolism
    109359355
   01040 Biosynthesis of unsaturated fatty acids
    109359355
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109359355
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109359355
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109359355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 109359355
NCBI-ProteinID: XP_019459535
Position
LG01
AA seq 684 aa AA seqDB search
MQTPTPNPEAERRIRNLTQHLNPLPRQLLSATNHHLAIEPCAAKTKLNVDTSSLSSYMSG
KHKDIQEKVINYFNANPHLQTPIEISKDDHRELCMKQLVGLVKDAGFRPLNYVLHDPSTY
FAILEAVGSYDMSLSVKMGVQYSLWGGSVLNLGTQKHKDKYFDGINNLDYPGCFAMTELH
HGSNVQGLQTVATFDPITDEFIIDTPNDGAIKWWIGNAALHGKFATVFARLKLPNYDTKG
VSDMGVHAFIVPIRDMETHQPLPGIEIQDCGHKVGLNGVDNGALRFRSVRIPRDNLLNRF
GDVSRDGKYTSTLPSENKRFAATLGELVGGRVGLAYSSVSVLKVAATIAIRYSLLRQQFG
PLNQPEVRILDYQSQQHKLMPMLASTYAFHFATTNLLDKYSEMKKTHNEELVADVHALSA
GLKAYVTSYTAKSLSICREACGGHGYAAVNRFGSLRNDHDIFQTFEGDNTVLLQQVAGDL
LKQYHGKFKGGTLAVTWSYLRESMNSYLSQPNPVTARWEGEDHLRNPKFQLDAFRYRTSR
LLHSVALRFRKHAKSLGTFGAWNRCLNHLLTLAESHIESVILAKFIEAVQSCPDPSSQAA
LKLVCDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLSEYLSFQVRNIAGELVDAFDLPE
HVTQAPIAMQSEAYSKYTQYVGFQ
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccccaacaccaaaccccgaagcagagaggcgaatcaggaacctaacccaacac
ctaaaccctcttccacgccaactcctctccgccacgaaccaccacttagccatagaacca
tgcgccgcaaaaacgaagctgaacgtggacacgtcatcgctatcttcttacatgagtgga
aaacacaaggacatacaagaaaaagtgatcaactacttcaacgcaaacccacaccttcaa
accccaattgagatatcaaaagacgatcatcgcgaactatgcatgaaacaacttgtgggt
cttgttaaagatgctgggtttaggcctttaaattacgtacttcacgatccctctacctat
tttgctatattggaagcggttggtagttatgatatgtcactatcggttaagatgggtgtg
cagtatagtttatggggtggctctgttttgaatttgggaactcagaagcataaggataag
tactttgatggcattaataacttggactacccgggttgttttgctatgaccgagcttcac
catggttcaaatgtgcagggccttcaaactgttgccacctttgatccaatcactgatgaa
tttatcattgatacgcctaacgatggtgccatcaaatggtggattggcaatgctgcattg
catggaaagtttgccactgtttttgccaggttgaagttacccaattatgacacaaaagga
gtttctgatatgggtgtccatgctttcatagttccaataagagatatggagacccatcaa
ccacttcctggaattgagatacaagattgtggtcataaagttggcctcaatggtgtggat
aatggagcattgagattccgatctgtaagaatcccccgagataatcttcttaaccgtttc
ggagatgtctcccgtgatgggaagtacacaagtacccttccttctgaaaataaacggttt
gctgcaactctaggggaacttgtaggtggaagggttggccttgcatattcttcggttagt
gtcctgaaggttgctgctacaattgccattcgatattctctacttcgtcagcaatttgga
cctctaaaccaacctgaagtcagaattcttgattaccagtctcaacagcataagctaatg
ccaatgttggcttcaacttatgcatttcatttcgccactacaaatttactggacaagtac
tctgaaatgaagaaaactcataatgaagagttagttgcagatgtccatgctctttcagca
ggtctaaaggcttatgtgacatcatatactgcaaaatcactgagcatctgtagggaagca
tgtggaggccatggttatgctgctgttaatcggtttggtagcttgaggaatgatcatgat
atttttcagacatttgaaggagacaacacggttcttcttcagcaggttgcaggtgatctt
ttaaaacaatatcatggaaagttcaaaggagggactcttgcagtgacatggagctacttg
agggaatccatgaattcatatctgtcacagccaaatccagttactgctcggtgggaaggt
gaagaccatttacgaaatcctaaatttcagttggatgctttcagataccggacatctagg
ttacttcatagtgttgctctacgatttcgaaagcatgctaaatctcttgggacctttgga
gcatggaatagatgcttaaatcaccttttgacccttgcagagtcacatattgagtcagtc
atccttgctaaattcattgaagcggtgcagagctgtcctgatccaagctcccaagctgct
ctgaaactagtctgtgatctttatgctctggatcgaatatggaaagacattggaacctac
cgtaatgttgactatgtggctcccaacaaagccaaggcaatccacaaactctcggagtat
ctgagtttccaagtgaggaacattgcaggggaacttgttgatgcattcgatcttccggaa
catgttacgcaggcccctattgccatgcagtcagaagcttactcaaagtacacacaatat
gtcggattccaataa

DBGET integrated database retrieval system