KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109359921Help
Entry
109359921         CDS       T04664                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109359921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lang03041]
    109359921
Enzymes [BR:lang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109359921
Spliceosome [BR:lang03041]
 Complex C
  Other components
   Step II factors
    109359921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 ABC_tran DUF2075 AAA_19 AAA_30 Helicase_RecD AAA_16 T2SSE AAA_29 AAA_23 AAA_14 ATPase_2 SRP54 Sigma54_activat PhoH AAA_33 DAP3 FtsK_SpoIIIE RsgA_GTPase NB-ARC DUF87
Motif
Other DBs
NCBI-GeneID: 109359921
NCBI-ProteinID: XP_019460163
UniProt: A0A1J7IH39
Position
LG01
AA seq 701 aa AA seqDB search
MATLPILQHEEKIIQTVNQNPVVVIIGETGSGKSTQLSQILHRHGYSNSGKIAVTQPRRV
AAVSVARRVSQELGVHLGEEVGYAIRFEDRTSHNTRIKYLTDGVLLRESLADPELNDYSV
VILDEAHERSLNTDILMGLMKRLVKVRSSDFKVLITSATLDGNKVSKFFTDCPVLTIPGK
LYPVEILYNKERPSSYLESSLKTALDIHARQPEGDILIFMTGQDDIEKLVSKLEDKVRAL
EEGSCMDAIILPLHGSLPPELQVRVFSPPPPNCRRIIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSAGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSRVYDDEFLDATVPE
IQRSSLAGCVLYLKSLDLPDIDILKFDFLDPPSSESLQDALKQLYLIDAIDENGAITNTG
QKMAELPLEPSLSRTLMEANNYGCISEALTVAAMLSAETALLSAPGRSKIERKRKNPVTN
LPDGSGLGDHIQLLQIYECWDQTDYDIGWCKDNGLQVRGMLFVRDVRKQLSQIMQKMAKG
PLDIRTNGKGEEFRKGYRNLRKALCTGYANQLAERKMHHNGYRILGFQSQVVQVHPSSVL
KADELGKFPDYVVYHELIATPRPYMRNVCSVEMRWVVPIINKLKTLDVYKLSGGVEHVEE
ETERNLPDFPKKDVDIVASGDDRESRIQAARERFLARKGNK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggccactcttccaatactccaacacgaagaaaagatcatacaaaccgttaaccaaaac
cctgttgttgtaatcattggagaaaccggttccggaaagagcacacaactctctcagatt
cttcaccgccacggttactccaattctggcaaaatcgccgtcactcagccccgccgtgtc
gccgccgtatctgtcgctagacgagtttctcaggaacttggggttcatctcggtgaggaa
gtggggtatgcaattcgatttgaggataggacttcacacaacacacgcataaaatacctt
actgatggggtcctcctccgggaaagtctagctgatcctgagctaaatgattattctgta
gtcatattggatgaagctcatgaacgaagtttaaacacggatattttgatggggttgatg
aaacgcttggttaaagttcgttcctctgacttcaaagttttgatcacatcagcgactctt
gatggcaataaagtatcaaagttctttacagattgtcctgtcttgacaattccaggaaag
ctgtacccagttgagatactttataacaaggagcgtccctcaagctatctcgaatcttct
ctgaaaacagctcttgatatacatgctcgtcaaccagaaggggatattttaatattcatg
actggacaggatgatatagagaagttggtatctaagttggaagataaagttcgggctctt
gaggaaggttcctgcatggatgctataatccttcccctacatggttctttgccacctgaa
ttgcaggtgcgtgtatttagtcctccacctccaaattgcagacgaattattgttgcaaca
aacattgctgaaacttctttgactgttgatggtgtagtgtatgtcattgactcagggtat
gtaaagcaaagacagtacaacccatctgctggcatgtattctcttgatgttgttcaaatt
agcaaagtgcaagctaatcagcgcgcaggccgagctggacgaacccgtccagggaaatgc
tatcgtctatatccttcccgagtttacgatgacgagttcttggatgctacagttcctgaa
atacagagatcttctctcgctggctgtgttctttacttgaagtcattggaccttccagat
attgacattctcaaatttgactttcttgatcctccttcatccgagtcattacaagatgcc
ttgaagcaattatacctgatcgatgcaattgatgaaaatggtgcaattacaaatactgga
caaaaaatggctgaacttccgttagaaccatccctctcgagaaccttaatggaggcaaac
aattatggttgcatatccgaggctttgactgttgctgccatgttatcagctgaaactgca
ttgctatcagcaccagggcggagcaagattgagagaaagaggaaaaacccagtaactaat
cttcctgatggttctggcttgggtgaccacattcaattgctgcagatatatgagtgttgg
gatcaaactgattatgacattggttggtgcaaagataatggcttgcaggtgcgagggatg
ttgtttgtccgagatgtgcgtaagcagttatctcagataatgcagaaaatggcgaaagga
ccactggatattaggacaaatgggaaaggagaagagttccggaagggttatcgaaatttg
agaaaagctttatgtacgggctatgctaatcagctggctgaaagaaagatgcatcacaat
ggctatcgaattctgggttttcaatcccaggtagtccaggtgcatccatcatccgtgctg
aaagctgatgaactgggcaagttcccggactatgttgtataccatgagctgattgcaact
ccacggccatacatgagaaatgtgtgttctgttgagatgagatgggttgtacccattatt
aacaagcttaagacactagatgtatacaaattgagtggcggtgttgaacacgttgaggag
gaaactgagagaaatctcccagattttcccaagaaggatgttgacattgttgcatctggt
gatgaccgtgaaagtagaatacaagccgctagagaacgcttccttgctcgcaaaggcaat
aaatga

DBGET integrated database retrieval system