KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109360911Help
Entry
109360911         CDS       T04664                                 

Definition
(RefSeq) N6-adenosine-methyltransferase MT-A70-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lang03019]
    109360911
Enzymes [BR:lang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     109360911
Messenger RNA biogenesis [BR:lang03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     109360911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 109360911
NCBI-ProteinID: XP_019461670
Position
LG11
AA seq 759 aa AA seqDB search
METQLDGNEDAIATIKDIRQQLEARIESQHKAHMEMLASIQTVIPNLVSSLDLSLKVVSS
FNHRPFAPTPPLPPPYPKLNPKKNVELTHHSNAETCSDGSIEADQTNPKSQKLKTSQDSN
PVGQVESESVSPIAVVRSMVAVCLLGRVPFSPIDSSTVLRKLQNDQTVTPAEKASLQELG
GDSGATLAVEIALRSMAKDNGGVELDEFVVSGTARIMVLNIDRTRLLRELPESAQYQQVE
SSSGDGNANQNQGQQITTSDTNANGGLLGMGRPILRQMSDMWMPHGEPHMSGMQPMFPGG
PRGAPRMMGMMGTPRGIGISPMHRFPLGPNAAGSNPNSMPQKPKTFEDEMKDVEALLNKK
SFREMQKSKTGEELLDLIHRPTAKETAVAAKFKTKGGSQVRQYCDLLTKEDCRRQSGSFI
ACDKVHFRRIIALHTDINLGDCSFLDTCRHMKTCKYVHYEYDPTPDVPPTVMGAPPPRPL
KPQRAEYCSEVELGESQWINCDIRNFRMDILGQFGVIMADPPWDIHMELPYGTMADDEMR
TLNVPALQTDGLIFLWVTGRAMELGRECLELWGYKRVEEIIWVKTNQLQRIIRTGRTGHW
LNHSKEHCLVGIKGDPEVNRNIDTDVIVAEVRETSRKPDEMYPLLERISPRTRKLELFAR
MHNTHAGWMSLGNQLSGVRLVDDGLRARFKAAYPDVEVQPSSPPRASAMEVDSNVAAQTR
SPFAITESKPTATQLADPTAPETSHASEEKPMAVDVEMN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggagacacaattggatggcaatgaagatgccatagcaaccattaaagacatacggcaa
cagctcgaagctcgtatagagtcccagcacaaggcgcacatggagatgcttgcttctata
caaaccgttatcccaaatcttgtttcctcccttgacctttctctcaaggtcgtgtcttct
ttcaatcatcgtccttttgcccctacccctcctctgcctccaccatacccgaaattgaat
cccaaaaaaaatgttgaattaactcatcactctaatgctgaaacttgctctgatggctct
attgaggctgaccagacaaatcccaagagtcaaaagctcaaaacgtctcaggattcaaat
ccagttggccaggtggagtctgagagtgtgagtccaatagcagtggttcgatcaatggtt
gctgtttgtctgttagggagagtacccttctccccaattgattcttccactgtgttaagg
aaattgcagaatgatcaaacagtgacaccagctgagaaggcttcacttcaggagcttgga
ggggattcaggggcaacactagcagtggaaatagctttgaggtcaatggccaaagataat
ggtggtgttgaactggatgagtttgtggtgagtggcacagcgagaattatggttttaaat
atagaccggactcgtcttctgagagaattgccagaaagtgcacagtatcagcaagttgaa
tcaagttctggagatggtaatgccaatcaaaatcaaggtcagcaaatcactaccagtgac
actaatgcgaatggtggtttgcttgggatgggaaggccaattctgaggcaaatgtccgat
atgtggatgccccatggggaaccccatatgtcagggatgcagccaatgtttccaggagga
ccaaggggtgcacctagaatgatgggcatgatggggacacccagaggtataggtatttca
ccgatgcatagattcccattggggccaaatgctgcagggagtaatcctaattcaatgcca
cagaaaccgaaaactttcgaggatgaaatgaaggatgttgaagctttgttgaataagaaa
tcatttagggagatgcaaaaatctaaaactggtgaggagcttttggacctaattcaccga
ccaactgcaaaggaaaccgctgtagctgctaagttcaaaaccaaaggtggttcacaagtg
agacaatactgtgacttactaacaaaagaggattgccgacgtcaatctggctcctttata
gcatgtgataaggttcattttaggcggatcattgcccttcatacagacatcaatttagga
gactgttcttttcttgatacttgccggcacatgaagacatgcaagtacgttcattatgag
tatgaccccacacctgatgtgcctccaacagtgatgggtgctcctcctcccagaccactc
aagccacagcgtgctgagtattgttctgaagtggaacttggtgagtcgcaatggatcaac
tgtgatatacgtaactttagaatggacatattaggtcaatttggagtaataatggcagat
ccaccatgggacattcacatggaactgccttatggaacaatggccgatgatgaaatgcgc
actcttaatgtccctgctctgcaaactgatgggctaatttttctatgggtcactggacgt
gcgatggagcttggacgtgaatgtttagaactttggggatataaacgtgttgaggagatc
atttgggtgaaaaccaatcaacttcagcgaataatcagaactggccgtacaggccactgg
ctgaatcacagtaaagaacattgtcttgttggaattaagggggatcctgaagtaaacagg
aacatcgacactgatgtaattgttgctgaggtccgggaaacaagccgaaagccagacgag
atgtatcctttgttggagaggataagtccaagaacaagaaagctggaattgtttgctcgc
atgcacaatactcatgcaggatggatgtcacttggtaatcaactgagtggtgtaaggttg
gttgatgatggtttgcgggcaaggtttaaggcggcttacccagatgtcgaggtccaaccc
tcgtcacctcccagagcttctgctatggaagtagattcgaacgttgctgctcaaacaagg
agtccatttgccatcacggaatcgaagcccaccgcaacacagcttgctgaccctacagct
ccagaaacttctcatgcttcagaggagaagccaatggctgttgatgtggaaatgaactaa

DBGET integrated database retrieval system