KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109361658Help
Entry
109361658         CDS       T04664                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 4, chloroplastic-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109361658
Enzymes [BR:lang01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109361658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 109361658
NCBI-ProteinID: XP_019462722
Position
LG12
AA seq 235 aa AA seqDB search
MLHLKICVKKMALSLSHSSIVILTAPTTNRKVKFGFSHSSPISCVWKPNDNSRKAHNLSC
SAHNNNKNPLVGISIGVIATCVIGLTPLDADATRIEYYATVAEPPCELKYAKSGLGYCDI
VEGFGDEAPLGELINVHYTARFSDGIVFDSSYKRARPLTMRIGAGKLIAGLDQGILGGEG
VPPMRIGGKRKLKIPPMLAYGPEPAGCFSGDCNIPGNATLLYDITFVEVYSGNRK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatctcaaaatttgtgtaaagaaaatggcactctcactctcacactcctccatt
gtaattctaaccgctcctaccacaaataggaaggtcaaattcggtttttctcactcttct
cctatctcttgtgtttggaaacccaacgacaatagtagaaaagcgcataacctttcttgt
tcagcacataacaacaataagaatccgttagttggtattagtattggggttatagctaca
tgtgtgataggtttaacgccgttagatgctgatgccactagaatcgaatactacgctacc
gttgcagagcctccgtgtgaactcaaatatgccaagtctgggcttggttactgtgacatt
gttgagggctttggtgacgaggccccacttggtgaacttattaatgttcactatactgca
cgattcagtgatggaatagtgtttgatagtagctataaacgtgctagacctctcactatg
cgcattggtgctggcaagctaatagcaggactggatcaggggattttagggggtgaagga
gtacctccgatgcggataggtgggaaacgcaaattgaagattcctccgatgttagcatat
ggccctgaacctgctgggtgcttctcaggtgactgcaatataccaggcaacgccaccctc
ctgtatgacattacttttgttgaagtttattcgggtaatagaaagtga

DBGET integrated database retrieval system