KEGG   Lentibacillus amyloliquefaciens: AOX59_01300Help
Entry
AOX59_01300       CDS       T04204                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00020  Citrate cycle (TCA cycle)
lao00620  Pyruvate metabolism
lao01100  Metabolic pathways
lao01120  Microbial metabolism in diverse environments
lao01200  Carbon metabolism
lao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOX59_01300
   00620 Pyruvate metabolism
    AOX59_01300
Enzymes [BR:lao01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AOX59_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp ATP-grasp_3 Dala_Dala_lig_C Biotin_lipoyl_2 RimK ATP-grasp_4 RnfC_N GCV_H ATPgrasp_Ter HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALX47353
UniProt: A0A0U4EA14
Position
263101..266544
Genome map
AA seq 1147 aa AA seqDB search
MGERNQINKILVANRGEIAIRVFRACTELNIRTVAVYSQEDIGSYHRYKADEAYLIGEGK
KPIDAYLDIEGIIDLAKRVDVDAIHPGYGFLSENIEFARRCEEEGIIFIGPTSEHLNMFG
DKVKARTQALNAKLPVIPGSDGPVSSLDEVKAFGKQHGFPIIIKASLGGGGRGMRIVRNE
QSLDEAFDRAKSEARAAFGSDEVYVERLIENPKHIEVQIIGDTYGNTVHLHERDCSVQRR
HQKVVEAAPSVSLPDKLREEICQAAVDLMDNVGYVNAGTVEFLVTDNDYYFIEVNPRVQV
EHTITEMITGIDIVQTQIKIAAGENIHDDSIGIPQQDGITTLGYAIQSRVTTEDPLNNFM
PDTGKIMAYRTGGGFGVRLDAGNGFQGAVISPHYDSLLVKVSTWALSFEQAAQKMVRNLK
EFRIRGIKTNIPFLANVISHQQFLSGAYRTTFIDQSPELFVFPKRKDRGTKMLTYIGHTT
VNGFEGLPNREKPSLMTPPIPEFDADSKIPDGTKQILDEHGPEYLAKWLKDNNNVMLTDT
TFRDAHQSLLATRIRTKDLVNIAEPTARMLPELFSVEMWGGATFDVAYRFLKENPWQRLL
KMREKMPNVLLQMLLRASNAVGYKNYPDNLIDEFVEKSATAGIDVFRVFDSLNWVEGMRP
AIQSVRKNNKIAEAAMCYTGNILDVGRSKYDLTYYKNLAKDLEQSGAHILGIKDMAGLLK
PEAAYQLISTLKETVDVPVHLHSHDTSGNGILMYSRAIEAGVDAVDVANAPMAGMTSQPS
AQTLYHALEGTSRQPQIDIDAYEQLGHYWQEIRNHYQDFESGLKAPHTEIYFHEMPGGQY
SNLQQQAKAVGLEERWNEVKTMFRRVNEMFGDIVKVTPSSKIVGDMALFMVQNDLNEDDI
YERGESIDFPESVIEFAQGLIGQPYQGFPKELQRIILKGKEPIDVRPGELLDPIDFTQLR
DSLFKSLDRQVTDFDLISSALYPKVFMDHHKFQETYGDVSVLDTLTFFYGMKLDEEIEVE
IEQGKTLHVKLMSISEPRADGTRVIYFELNGQARQVVVKDENVESEVEARPKVNKNDEKQ
IGATMPGTVVKVISDKGEEVQKGDHLLINEAMKMETTVQAPFSGVIKDIYVKDGDTIAVD
DLLIEFE
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaagaaaccaaatcaataaaattctagtagcaaatcgcggagaaattgctata
cgtgtttttcgtgcatgtactgaacttaatatacgcacagtcgctgtttactcacaggaa
gatattggttcataccatcgctacaaagctgacgaagcatatttaatcggcgagggaaaa
aaaccgatcgacgcttacttggatattgaaggaatcatcgatcttgccaaaagggtagac
gttgatgcgattcatccagggtatggttttctgtcggaaaacattgaattcgcccgtcgc
tgtgaagaagagggaatcatcttcattggcccgacaagcgaacatttaaatatgtttggt
gacaaagtgaaagcaagaacacaggctcttaatgctaaattgccggtgattccgggaagt
gacggtcctgtttcatcattggacgaggttaaagcgttcggcaaacaacatgggttcccg
attatcataaaagcatcactcggaggcggcggccgcggtatgcggattgtccgaaatgag
caatcgcttgatgaagcatttgaccgggctaaatccgaagcaagagcagcatttggcagt
gacgaagtgtatgttgaaagattaatcgaaaaccctaaacatattgaagttcaaattata
ggtgacacatacggcaataccgttcatttacatgagcgtgactgttctgtccagcgccgg
caccaaaaagttgttgaggcagcaccgagtgtttcactccctgataaattaagggaagaa
atatgtcaggctgcagttgatctgatggataatgtcggttatgtgaatgccggcacggtt
gaatttttggtaacagataacgattattactttattgaggttaacccccgtgttcaggtg
gaacataccattacggaaatgattacaggaatcgacatcgttcaaacacagatcaaaatt
gctgcaggtgaaaatattcatgatgattcaataggcattccacagcaggacgggattaca
acattgggctatgccatccagtcacgggtgacgaccgaagacccgcttaataacttcatg
ccggatactggaaaaatcatggcttaccggacaggtggcggctttggcgtaagactcgat
gcaggtaatggctttcaaggggcggttatttcaccgcattatgattccttgctcgttaaa
gtctcaacatgggctctgtcctttgaacaggctgcacaaaaaatggtcagaaacttgaaa
gaattccggatacgcgggattaagacaaacattccatttttggcaaatgtgatttcacac
caacagtttctatccggagcgtacaggaccacatttattgatcagtcaccggaattgttc
gtatttccgaaacggaaagaccgcggaactaaaatgttgacttatatcggccatacgacc
gttaacggttttgaaggattgccaaatcgggaaaagccatcattgatgacaccgccgata
ccggaatttgacgcggattcaaaaatacctgatggtacgaagcaaattcttgatgaacac
ggaccggaatatttggcaaaatggctgaaagataataacaatgtgatgctcactgataca
actttccgtgacgcgcatcagtcactattggcaacacggatcagaacaaaagatctcgtc
aatatcgctgaaccgactgcgcggatgctgccggagctattttcggttgaaatgtggggc
ggtgcaacatttgatgtggcataccgcttccttaaagagaatccatggcagcgcttgttg
aaaatgcgtgagaaaatgccgaatgttctgctgcaaatgctcctgcgtgcgagcaatgca
gttgggtataaaaactatccggataatttgattgacgaatttgttgaaaagagtgccaca
gcagggattgatgtgttccgggttttcgacagtctgaattgggttgagggtatgagaccg
gccattcaatctgtaaggaagaataataaaattgcagaagcagcgatgtgctatacaggc
aatattctggatgtcggccgttcaaaatatgatctcacttactacaaaaatctggctaag
gatctggaacaatcaggtgcgcatattctcggcatcaaagacatggcagggcttctaaaa
cctgaagctgcctatcagcttatttcaactctgaaagaaacagtagatgtgcctgttcat
ttgcattcacatgatacgagcggtaatggtattctcatgtattcaagggcaattgaagca
ggcgtggatgcagtcgatgtggcaaatgcaccaatggccggcatgacatctcagccaagt
gcccagacattgtatcatgcactggaaggaacaagccgccagcctcagatagatattgat
gcctatgaacaattgggtcactattggcaagaaatccgcaatcattatcaggatttcgaa
agcggcctaaaagcaccgcatactgaaatatacttccacgagatgccgggcggccaatac
agcaatttgcagcagcaggccaaagcggttggacttgaagagcgatggaacgaagtgaaa
accatgttcagacgggttaatgaaatgttcggggatatcgttaaagtaacaccttcgtca
aaaattgttggtgacatggcattgttcatggtgcagaatgatttaaatgaagacgatatt
tatgaacgcggcgaatcgatcgatttccctgagtctgttattgaattcgcacaaggcttg
attggacagccatatcaaggttttccaaaagaattgcagcggattatcttaaaaggaaaa
gaaccgattgatgtacgtccgggtgaattgcttgacccgattgatttcacgcaattgcgc
gactcgctctttaaatcgcttgatcggcaggtaacggatttcgacttgatttcttctgca
ctttatccgaaagtattcatggatcatcacaagttccaggagacgtacggagatgtatcg
gtactcgataccttaaccttcttttatggcatgaaattggatgaagaaatcgaagtggaa
attgaacaagggaaaacactgcatgttaaactgatgtcgatttccgaaccgcgggcggac
ggtacacgtgttatttatttcgaattaaacggacaagcaagacaggtcgttgtgaaagat
gaaaatgtggaatcggaagttgaagcacgtcctaaagtcaataaaaatgacgaaaaacaa
atcggagcaacaatgccgggaacagtcgtcaaagtcatatctgataaaggggaagaagtt
cagaagggtgaccatttgttaataaatgaagcaatgaaaatggaaacaactgttcaagcg
ccattttcgggtgtcatcaaagatatctatgtaaaagatggcgatacaattgctgtagat
gacttgctgattgaatttgaataa

DBGET integrated database retrieval system