KEGG   Lentibacillus amyloliquefaciens: AOX59_04460Help
Entry
AOX59_04460       CDS       T04204                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00670  One carbon pool by folate
lao01100  Metabolic pathways
lao01120  Microbial metabolism in diverse environments
lao01200  Carbon metabolism
Module
lao_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AOX59_04460
Enzymes [BR:lao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AOX59_04460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA Inhibitor_I78
Motif
Other DBs
NCBI-ProteinID: ALX47921
UniProt: A0A0U4E4V3
Position
complement(897833..899503)
Genome map
AA seq 556 aa AA seqDB search
MKSDIEIAQETDLKPIEEIAGKLGLEREDWEPYGHTKAKLSKTLHNKLNDQPNGKVILVT
SINPTPAGEGKSTVTVGLGQAMEKFGKKAMIALREPSLGPVMGIKGGAAGGGYSQVLPME
DINLHFTGDLHAITTANNALSAMIDNHIHRGNSLNIDPRRIEWKRVMDMNDRALRQIVVG
LGGPSRGVPREDGFNITVASEIMAILCLATSLEDLKARIAEIVIGYTYDEAPVTAGDLNV
EGALTLLLKEAIKPNLVQTTENTPAVIHGGPFANIAHGCNSIMATKTAAKLSDYVVTEAG
FGADLGAEKFLDIKSRAGEFNTDAVVIVATVRAIKMHGGVNRDNLTTENIGALEKGIENL
AKHMETIESFGLPYVVAINKFPSDSAAEIEYITSWCESRNTDVALTDVHANGGEGGMELA
EKIVEKTDAPSQNFNYIYDLNDPLETKIRKIAQAVYGADDIDLSEKAKKQLAFYEQEGWG
KLPVCMAKSQYSLSDDPSLLGRPKNFNVKIRELRPSIGAGFIVVLTGNMMTMPGLPAKPA
ALNMDVDENGKALGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagatattgaaattgcgcaagagaccgatttaaaaccaattgaagagatcgcg
ggaaagcttggtctggaacgtgaagactgggaaccttatggacacaccaaagccaaactt
tcgaaaacattgcataataaattaaacgatcaaccaaacggtaaagtcattttagttact
tcgatcaatccaacaccggcaggagaaggtaaatcgacagtgacagtaggattgggtcag
gcaatggagaagttcggcaagaaagcgatgattgctttgcgagaaccatccttaggccct
gtcatggggataaaaggcggagcagccggcggaggatattcgcaagtgttgccaatggaa
gatattaaccttcatttcacgggagacttgcacgcaattacgactgccaataatgcgttg
tcagctatgattgataatcatatacacagagggaactcactgaacattgatcctcgtcgt
attgaatggaaacgagttatggatatgaacgaccgggcattaaggcaaatcgtcgttgga
cttggcggaccgtcacgcggcgtacccagggaagatgggtttaatataaccgtcgcttct
gaaataatggcaattttatgccttgcaacaagtttggaggatttaaaagcgaggattgcc
gagattgtaatcggttatacatacgatgaagcccccgtcactgcaggagatctaaatgtg
gagggagcattgacactcttattaaaagaggccattaagcctaacttggtccagacgact
gaaaatacacctgctgtcattcatggcggtccgtttgccaatattgcccacggatgcaat
agcattatggcgacaaagaccgctgccaaactaagcgattacgtcgtcacagaagcaggt
tttggagcagatcttggtgctgagaagtttctggatatcaaatcccgtgctggtgaattt
aatacagatgctgttgttatcgtggcaactgtacgtgctataaagatgcatggcggtgtt
aatcgtgataacctgaccactgaaaatattggggcactggaaaaaggtatcgaaaacctg
gcgaaacacatggaaacaattgaatcatttgggctgccatacgtagtcgccatcaataaa
ttcccatccgattcggctgcagaaattgaatacattacgtcatggtgtgagtcgagaaat
actgatgtggctttaacagacgtacacgcaaacggtggtgaaggcggcatggaacttgct
gaaaaaattgttgaaaaaactgatgcgccttcccaaaatttcaactatatatatgattta
aatgatccgcttgaaacaaaaatcaggaaaatagcccaagctgtatacggtgctgatgat
attgacttatctgaaaaagccaaaaaacaacttgccttctacgaacaagaagggtggggt
aagcttccggtatgtatggcaaagtcgcaatactcattgtctgatgatccgtctttattg
ggaagacctaaaaatttcaacgtcaaaatcagagaattgcgtccttcaataggggcagga
ttcatcgttgtgttaacgggtaatatgatgacgatgccgggcttgccggcaaaaccggcc
gcgcttaatatggatgtagatgaaaacggaaaggcgctcggattattttaa

DBGET integrated database retrieval system