KEGG   Lentibacillus amyloliquefaciens: AOX59_08395Help
Entry
AOX59_08395       CDS       T04204                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lao  Lentibacillus amyloliquefaciens
Brite
KEGG Orthology (KO) [BR:lao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lao03009]
    AOX59_08395
Enzymes [BR:lao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AOX59_08395
Ribosome biogenesis [BR:lao03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AOX59_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Ub-Mut7C Cupin_3 S4_2
Motif
Other DBs
NCBI-ProteinID: ALX48627
UniProt: A0A0U4F766
Position
complement(1676165..1677040)
Genome map
AA seq 291 aa AA seqDB search
MKWTVTKQQEGLIIRSFLQREQKFSKRMIKHIVHGGGTIKVNGTPQTVRYELRAGDVVAV
SPPDEKKGAMMIPEKMPLDIVYEDDAVLVINKSPGRAVIPSYQYTSGTIANGVLAHYEAQ
GLPYTFHVVTRLDRNTSGLMLIAKHRWSHSILSETQKAGIIKRSYFAVIEGHLQEKNETI
NAPIGRKEGSIIERTVTTGGKHAITHYSVLTEYDNHTLIHVELETGRTHQIRVHFSHFGH
PLAGDNLYGGETNNIERQALHCHRLAFEHPFTGEWEEFTAELPNDMKPDKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggacggtaaccaaacagcaggaaggcttaatcatacgaagctttttacagcgg
gagcaaaaattttccaagcgcatgattaagcatatcgttcacggcggcgggacaataaag
gtgaatggaacccctcagacagtccgttatgaattgagggcaggtgatgtggttgctgtt
tcacctcccgatgagaaaaaaggggccatgatgattccggaaaaaatgccgctcgatatt
gtgtatgaagatgatgcggttctggttatcaataaatcacccggaagggcagtcatccca
tcctatcagtatacgtccggcacgattgccaatggggtgctggcgcattatgaagcgcaa
ggccttccttacacatttcatgtcgtgacacggcttgacaggaatacatccggcctcatg
ctgattgccaagcatcgttggagccattcgatcttatccgagactcaaaaggctggaata
atcaaacgcagttattttgccgtcattgaaggccatttgcaggaaaaaaatgaaaccatc
aatgcaccaatcgggcgtaaagaaggttcgatcattgagcggacggttaccaccggaggc
aaacatgcgattacccattattcggtcttaacggaatatgataaccacacacttattcat
gttgagctggaaaccggccgtacccatcaaattcgtgtgcatttttcacatttcggacat
ccgttggcaggcgataatctgtacgggggagagaccaataatattgaacgtcaggctttg
cattgtcacaggttagcgtttgagcatccattcacgggtgagtgggaggagttcaccgct
gaattgccgaatgatatgaaaccggacaaattgtag

DBGET integrated database retrieval system