KEGG   Lentibacillus amyloliquefaciens: AOX59_14835Help
Entry
AOX59_14835       CDS       T04204                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOX59_14835
Enzymes [BR:lao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AOX59_14835
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AOX59_14835
    1.1.1.-  
     AOX59_14835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ALX49735
UniProt: A0A0U4F2L3
Position
2936845..2937894
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGKKDLRVEEIELKQTKDTDVKVRVAWAGICGSDLHEYEEGPVFVPNEKEDPLT
GEIAPLTMGHEFAGVIEEVGPKVTKYKVGDRVAINPTITYGNKSEDLDPYDGFSFIGLHG
DGGFTKYANVPEDNVYLLPESLTLQDGALVEPTAVAVQAVKEGKLQFGDTVAVFGAGPIG
LVTIIAAKAAGASKIIALDLSETRIEKAKELGATHVVNSSEQDAVTAIKEIVPDGVDVSF
EVAGVAPTFKQAIDATRARGTMVIVSIFAREIEWNPIQLTNTGVKVTSTIAYTPTTFQQT
VDLMGTGQLKPQGIITDQIQLDDIVENGFEALTNDKSQAKILVELSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtctggtatggaaaaaaagacttacgggtagaggaaatagaactaaaa
caaacgaaagataccgatgttaaagtaagggtagcttgggcaggtatttgtggcagtgat
ttacatgagtatgaagagggaccggtgtttgtaccaaatgaaaaagaggatccgttaact
ggagaaatcgctccgctaaccatggggcatgaatttgcgggtgttattgaagaagtaggt
ccaaaggtgacaaaatataaagttggcgatagagtagcaattaatccaacaatcacttat
ggaaataagtcggaagaccttgatccttatgatggtttcagctttatcggccttcacggt
gacggtggttttactaaatatgcaaatgtaccagaagataacgtttatctacttccagaa
tctttaacactacaggatggagctttagtagaaccaactgcggttgccgtacaagctgta
aaagaagggaaactgcagtttggtgatacggtagctgtatttggtgcaggtccaattggt
ttagtgacaattattgcagctaaagctgctggtgccagcaagattattgctttagatttg
tcggaaactagaattgaaaaagcaaaagaattaggagcaacccatgtcgttaactctagc
gaacaagatgctgttacagcaatcaaggaaattgttccagatggagtagatgtttccttt
gaagttgccggagtagcaccaacatttaaacaagcaattgatgcaacaagggcacgtgga
acaatggttattgtttctatatttgctagggagattgaatggaatccaatacagcttaca
aatacaggtgtaaaagttacatcaacaatcgcatatacacctactacattccaacaaact
gtagatttaatgggaacaggacaattaaaaccacagggaattattacagaccaaattcaa
ttggatgatattgttgaaaatggattcgaagcattgacaaacgataaatcacaagcaaaa
atattagtggaattaagtggtgagaaataa

DBGET integrated database retrieval system