KEGG   Lentibacillus amyloliquefaciens: AOX59_18540Help
Entry
AOX59_18540       CDS       T04204                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00071  Fatty acid degradation
lao00072  Synthesis and degradation of ketone bodies
lao00280  Valine, leucine and isoleucine degradation
lao00310  Lysine degradation
lao00362  Benzoate degradation
lao00380  Tryptophan metabolism
lao00620  Pyruvate metabolism
lao00630  Glyoxylate and dicarboxylate metabolism
lao00640  Propanoate metabolism
lao00650  Butanoate metabolism
lao00900  Terpenoid backbone biosynthesis
lao01100  Metabolic pathways
lao01110  Biosynthesis of secondary metabolites
lao01120  Microbial metabolism in diverse environments
lao01130  Biosynthesis of antibiotics
lao01200  Carbon metabolism
lao01212  Fatty acid metabolism
lao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOX59_18540
   00630 Glyoxylate and dicarboxylate metabolism
    AOX59_18540
   00640 Propanoate metabolism
    AOX59_18540
   00650 Butanoate metabolism
    AOX59_18540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOX59_18540
   00072 Synthesis and degradation of ketone bodies
    AOX59_18540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOX59_18540
   00310 Lysine degradation
    AOX59_18540
   00380 Tryptophan metabolism
    AOX59_18540
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOX59_18540
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOX59_18540
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOX59_18540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lao04147]
    AOX59_18540
Enzymes [BR:lao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOX59_18540
Exosome [BR:lao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOX59_18540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ALX50400
UniProt: A0A0U3WBH1
Position
3780155..3781342
Genome map
AA seq 395 aa AA seqDB search
MSELKEAVVVSGARTPIGKFGGSFKDVHSTDLAAYAVKEALKRGEVKPESVDELIIGNVG
QIAENGFIGRVVSLKSDLPDSTTAYSVNRQCGSGMQSIVDGMMQIQTGNSEVVVASGTEN
MSQLPYYLKGARFGYKMGHGDLEDGLLSILTWPSGPYHNGVTAENVAEEYDVSRQEQDEF
SLKSQERAVQAIKDGKFKDEIVPVEVKDKKGNVSIVDTDEHPREGLTMEKLGKIKPAFKK
DGSVTPANSSGINDGAAAVVLMSKEKAEELGVKPLLKIKGFSIAGNDPGLMGYAPKLSTE
KLAEKCDVDLDDVDIYELNEAFASQSCAVIRDLKLDSNKVNVNGGAISLGHPVGATGTIL
TVKLMYEMHRAELDKGIVTMCIGGGQGISTLFERC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattaaaagaggccgttgtagtctccggtgcaagaacaccaattggtaaattc
gggggaagttttaaagacgtccattcaaccgatttagcagcatacgcagtaaaagaggcg
ttaaaaaggggagaagtcaaacctgaaagtgtagacgaattaattataggtaatgtcggg
cagatagctgaaaatggatttataggaagagttgtttcgttaaaatctgatttgccagat
tcaactacagcatattccgttaatagacagtgcgggtcaggaatgcaatccattgtagat
ggaatgatgcaaattcaaacggggaactcagaagttgtagtggcttctggcacggaaaat
atgtctcaattaccatattatttaaaaggtgcacgatttggatacaaaatgggacacgga
gatctagaggatggcttattatcaattttaacctggccaagtggaccatatcataacggt
gttacagctgaaaatgtagcggaagaatatgatgtatcaagacaagagcaggatgaattt
tcgttaaaaagtcaggaaagagcggttcaggcaattaaggatggtaaattcaaggatgag
attgtccctgttgaggtaaaagataaaaaaggaaatgtatcaattgttgatacagatgaa
caccctagagaaggtcttactatggaaaaactggggaaaattaaaccagcctttaaaaaa
gatggatctgtcacacctgctaactcttccggtattaatgacggggcagctgcagtagtg
ttgatgtcaaaagaaaaagcagaagaattaggggttaagccgttattaaaaataaaagga
ttttcaatcgctggaaatgatccaggtttaatggggtatgctcctaaattatcaacagag
aaattggctgaaaagtgtgacgtcgatttagatgatgttgacatttatgaactgaatgag
gcttttgcatctcaatcatgtgccgtcattcgagatttgaaacttgattcaaataaggtg
aatgtaaatggtggagcgattagcttaggtcatccagtaggagcaacaggtactatatta
acagttaaattaatgtatgaaatgcatcgtgccgagttagataaaggaattgttactatg
tgcattggtggcggacaaggcatttcaacattatttgaaagatgttaa

DBGET integrated database retrieval system