KEGG   Labrenzia sp. CP4: ACP90_02130Help
Entry
ACP90_02130       CDS       T04295                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00790  Folate biosynthesis
lap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACP90_02130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lap04147]
    ACP90_02130
Enzymes [BR:lap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     ACP90_02130
Exosome [BR:lap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACP90_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AMN51438
Position
433920..434219
Genome map
AA seq 99 aa AA seqDB search
MVERLKPEDRAAGLNDLPGWHMCEDREAISKSFKFHNFREAFAFMTQIALVAEKMNHHPE
WFNVYRSVDITLSTHDVGGLSKLDLQLAADIDKIAGKMQ
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacgactgaagccggaagaccgcgccgccggattgaacgatctgccgggctgg
cacatgtgcgaagaccgggaggcgatatcgaaatccttcaagtttcacaatttccgcgaa
gcctttgccttcatgacccagatcgcgctggtggcagaaaagatgaaccaccatcccgaa
tggttcaatgtctatcgcagtgtcgatattaccctgtcgacccatgacgttggcgggctc
agcaaactggacctccagctcgcggcggatatcgacaagattgccggcaagatgcagtga

DBGET integrated database retrieval system