KEGG   Labrenzia sp. CP4: ACP90_15475Help
Entry
ACP90_15475       CDS       T04295                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00511  Other glycan degradation
lap00520  Amino sugar and nucleotide sugar metabolism
lap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACP90_15475
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACP90_15475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lap03110]
    ACP90_15475
Enzymes [BR:lap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACP90_15475
Chaperones and folding catalysts [BR:lap03110]
 Intramolecular chaperones
  Others
   ACP90_15475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: AMN53595
Position
3334509..3336419
Genome map
AA seq 636 aa AA seqDB search
MTKIVLDCFYRPAEDLAASRQEFALTNTSSRPLKDFTLAYTAVNRATANAKLENAASFSR
IANFHEITPNTGETIEPGETWTFAITGLANVARHRLDGPKSAYVSTGGSVIEVVCNDLEA
PEELDSGERRSIPAGHLPEPLHIVPWPQKVEVTAFADDKTSFLVAQGSAEEKAAAAKINA
LAARLFPGAPHPFRFTQSHHQIAIEFRQDDSLAADGYRLEFAQAKAALRYSGSVGRDYGL
TVLAQMAYGTYEAPGTFKFPAQGVIEDAPRFSWRGTHLDVSRHFRGPKDIMRLLDILAWG
RMNVFQWHLTDDEGWRLEIKAYPELTVGGARRGPGCQQVPQLGFAAEVYEGAYSQDEVRE
IVAHATSLNIDILPEIDVPGHSTAVLKTYPRFADQAETPESYHSIQGYPNNALNPAMDET
YEFLEKVFAEVASLFPFDFIHIGGDEVDVNSWLASPKTQRLMEEKGLADTMEVQAYFMGR
VRDILRKLNRKLAGWDEVSHGGGIDPDGVLLMAWQRQEVTKDLIDQGYDVICTPGQHYYM
DMVQASGWHEPGAGWAGVSTPEDCYGYEAAAGLSTGSEARLKGVQACIWCEHMTDNVIFN
HMVFPRLYAVAEAGWTDPASKAWLRFAAQAPFFPQL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagattgtgctcgactgtttctaccgccctgcggaggatcttgctgcgtctcgt
caggagtttgcactgaccaatacaagctccaggcccctaaaggatttcacgctggcctac
acggcggtcaaccgggccacggcaaatgccaagcttgaaaacgcagcgagtttcagccgg
attgcgaattttcacgaaatcacgccaaacactggcgaaacgatcgaaccaggcgaaacc
tggacctttgccatcaccggcctggcgaacgtggcaagacaccggcttgatggtccgaag
tccgcctatgtcagcaccggtggcagcgtcatcgaggtggtgtgcaatgatcttgaagcg
ccggaagagctggacagcggagaacgccgcagcataccggctggacaccttcctgaaccg
ctgcatatcgttccctggccccagaaagtggaagtaacggcctttgcggacgacaagaca
agcttcctagttgcccagggctctgcagaggaaaaggcggcggcggccaagatcaacgcg
ctcgcagcaaggctctttccaggagcgccacatcctttccgttttactcaatcgcatcat
caaatcgcgattgagttccgacaggacgatagccttgcagctgacggttaccggctcgaa
tttgcccaagcgaaagcagccttgcgctacagcggctccgttggccgtgactatggcctg
actgtactcgcccagatggcttacggcacctatgaggcacctggtacattcaagtttcct
gcacaaggcgtgattgaagacgcgccaagattttcctggcgtggaacgcatctggatgtg
tcacgacatttccgtggccccaaagacatcatgcggctgctcgacattctcgcttggggt
cggatgaacgtcttccaatggcatctgacagacgatgaaggctggcgacttgaaatcaag
gcctatcccgaactaaccgtgggcggcgcgcggcgtggccctgggtgccagcaggtgccc
cagcttggctttgccgctgaagtctacgaaggggcttattcgcaggacgaggttcgcgag
attgtcgcccatgccaccagcctgaacatagatatcctgccggaaatcgatgttccgggg
cattcaaccgccgttttgaagacctacccgcgcttcgccgatcaggcggagaccccggag
agctaccattccattcagggctatccgaacaacgcactgaacccggcgatggatgaaacc
tacgagtttctcgaaaaggtctttgcggaagttgccagcctgtttccgttcgacttcatc
catatcggcggcgacgaagtcgacgtcaattcatggcttgcctcgccgaagacccaacgc
ctcatggaggaaaagggtcttgcggatacaatggaagtgcaagcctatttcatgggccgc
gtgcgcgacatcctgagaaaactcaaccggaaacttgccggttgggacgaagtctcacac
ggtggtggcatcgacccggatggcgtgcttctgatggcctggcaaagacaggaagtcacc
aaggacctgatcgatcagggctacgacgtcatctgcaccccaggacagcactattacatg
gatatggtccaggcgtccggttggcatgaaccgggtgcgggttgggccggcgtttcgaca
ccggaagactgttacggctacgaagcagctgccggtctcagcaccggcagtgaagcgcgc
ctcaagggggtgcaggcctgcatctggtgcgagcacatgaccgacaacgtcatcttcaac
catatggtctttccgcggctttatgcggtcgctgaagccggctggaccgatcccgccagc
aaggcctggctgcgatttgcagcacaggcccccttcttcccccagctttga

DBGET integrated database retrieval system