KEGG   Labrenzia sp. CP4: ACP90_21650Help
Entry
ACP90_21650       CDS       T04295                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00071  Fatty acid degradation
lap00072  Synthesis and degradation of ketone bodies
lap00280  Valine, leucine and isoleucine degradation
lap00310  Lysine degradation
lap00362  Benzoate degradation
lap00380  Tryptophan metabolism
lap00620  Pyruvate metabolism
lap00630  Glyoxylate and dicarboxylate metabolism
lap00640  Propanoate metabolism
lap00650  Butanoate metabolism
lap00900  Terpenoid backbone biosynthesis
lap01100  Metabolic pathways
lap01110  Biosynthesis of secondary metabolites
lap01120  Microbial metabolism in diverse environments
lap01130  Biosynthesis of antibiotics
lap01200  Carbon metabolism
lap01212  Fatty acid metabolism
lap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACP90_21650
   00630 Glyoxylate and dicarboxylate metabolism
    ACP90_21650
   00640 Propanoate metabolism
    ACP90_21650
   00650 Butanoate metabolism
    ACP90_21650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACP90_21650
   00072 Synthesis and degradation of ketone bodies
    ACP90_21650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACP90_21650
   00310 Lysine degradation
    ACP90_21650
   00380 Tryptophan metabolism
    ACP90_21650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACP90_21650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACP90_21650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP90_21650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lap04147]
    ACP90_21650
Enzymes [BR:lap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACP90_21650
Exosome [BR:lap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACP90_21650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Lactamase_B_6
Motif
Other DBs
NCBI-ProteinID: AMN54573
Position
4723565..4724773
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKKDGSLHEVPAVRLAATALEAIRDRNGLDTTRVDDVVLGCVDP
VGEAGGDIARAAVFAAGYDKSVPGMQINRFCASGLDAVNMASAQVMAGQHKLVIAGGVES
MSRVGLGASGGAWPIEPQVAIPSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRAGKS
WEDGRFSGSVVPVKDVNGITILDRDEHMRPETDMQSLASLNPSFEMMGNMGGFDAVGIQA
HPEIEKITHVHHAGNSSGIVDGAAAVLIGSSTAGRSSGLKPRARIKAFANIGSEPALMLT
GPVDVTEKLLKNAKMDIKDIDLIEINEAFASVVLRYQQAFDLDPATVNVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcctatatctacgaccacgtgcgcacgccgcgcggacgcggcaagaaggac
ggttcgctgcacgaagtgcccgccgtccggcttgcggccaccgcgctggaagcgatccgc
gaccggaacggtctcgacacgacccgggtggacgacgttgtcctgggctgtgtcgacccg
gtcggggaagccggaggcgacattgcccgtgcggcggtgtttgcggccggttacgacaag
tcggttccgggcatgcagatcaaccgcttctgcgcctccggtctcgacgcggtcaacatg
gcttcggcccaggtcatggcaggccagcacaagctggtaatcgccggcggcgtggaaagc
atgagccgtgtcggccttggcgcttccggcggtgcctggccgatcgagccgcaggtggcc
atcccctcttatttcatgccccagggcgtctcggctgatctgattgccaccaaatacggt
ttttcgcgcgatgactgcgatgcctatgcggtggaaagccagaagcgcgccggcaagtcc
tgggaagatggccggttctccggatccgtcgtgccggtgaaggacgtcaacggcatcacc
attcttgaccgggacgagcacatgcggccggaaaccgacatgcagtcgctcgcctcgctc
aacccctccttcgaaatgatgggcaacatgggcggtttcgatgcggtcggcatccaggcg
catccggaaatcgaaaagatcacccatgtgcaccacgccggcaactcctccggcattgtc
gatggagctgccgccgttctgatcggttccagcaccgcaggccgttcctccggcctgaag
ccgcgtgcacgcatcaaggctttcgccaatatcggttccgaaccggccctgatgttgacc
ggtccggtggatgttaccgaaaagcttctgaaaaacgccaagatggacatcaaggacatt
gatctcatcgagatcaacgaagcctttgcctccgtcgtcctgcgttaccagcaagccttc
gatcttgatccggcaacggtcaacgtcaacggcggtgcgattgccatgggccatcctctc
ggcgccaccggcgccatgatccttggcaccgtgctcgacgaactggaacgccgcgatctc
aacaccgctctcgtcacgctgtgcatcggcgcgggcatgggaacagcgaccatcatcgag
cgggtctga

DBGET integrated database retrieval system