KEGG   Labrenzia sp. CP4: ACP90_21740Help
Entry
ACP90_21740       CDS       T04295                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
lap  Labrenzia sp. CP4
Brite
KEGG Orthology (KO) [BR:lap00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ACP90_21740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD Arch_flagellin
Motif
Other DBs
NCBI-ProteinID: AMN54586
Position
complement(4743760..4744161)
Genome map
AA seq 133 aa AA seqDB search
MSGSYTAITQGIEVSVEPFYLDDESRPEESEYIWAYMVEIHNGGSEPVQLKTRYWQITDA
RGRQEEVSGEGVVGEQPVIEPGETYEYSSHCPLSTDSGIMAGSYSMERPDGSMFDVVIPA
FSLDLPDAIHSLN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgtctggcagttacaccgccatcacccaagggatcgaagtctccgtcgagccgttttat
ctggacgatgaatcgcgtccggaagagagcgagtatatctgggcgtatatggtcgagatc
cacaatggtggcagcgaaccggtgcagctgaagacgcgttactggcagataaccgacgcc
agagggcgccaggaagaagtcagcggcgagggcgtggtcggcgaacagccggtgatagag
cccggcgagacctatgagtattcgtcgcactgcccgctttcgaccgacagcggcatcatg
gccgggtcctactcgatggaacgtccggacggctccatgttcgacgtcgtcattccggcg
ttttcactcgatctgccggatgcgatccacagcctgaattga

DBGET integrated database retrieval system