KEGG   Labrenzia sp. CP4: ACP90_25200Help
Entry
ACP90_25200       CDS       T04295                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00480  Glutathione metabolism
lap00590  Arachidonic acid metabolism
lap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ACP90_25200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACP90_25200
Enzymes [BR:lap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACP90_25200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMN56263
Position
5479267..5479815
Genome map
AA seq 182 aa AA seqDB search
MAATCLCAVAQAKDLEGQSEAAQSAHAFTFEMPYGEPIALKDYAGKAILIVNTATECGFS
GQLAGLQKLHESYSDRGLLVLGVPSNDFGGQEPRADGDIAKFCEAKYGAEFPLAAKTVVK
GEKAHPFYRWAASELGPTARPYWNFHKYLVGPDGSILAWFPTPVPPTSSDVTAAIEKALP
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ctggcggcaacgtgcctttgtgccgttgctcaagccaaggacctcgagggccaaagcgaa
gcagctcagtcggcccatgccttcaccttcgaaatgccctatggcgaaccgattgcgctc
aaggattatgccggcaaggccattctgatcgtcaacacggcaacggaatgcggcttcagc
gggcaactggccggcttgcagaagctgcatgaatcctattcggaccgcggcttgcttgtg
ctcggggttccgtccaacgatttcggcggccaggaaccgcgtgccgacggcgacatcgca
aagttctgcgaagccaagtacggtgccgaatttccacttgccgccaagacggtcgtgaag
ggcgaaaaggcccatcctttttatcgatgggccgcaagcgagcttggccccacggcacgc
ccctactggaacttccacaagtatctcgtcgggccagacggcagcatccttgcctggttc
ccgacgcctgtgccgccgacttcatcggacgtgaccgccgcgatcgagaaggccctgccc
ggatcctga

DBGET integrated database retrieval system