KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_1294Help
Entry
GLA29479_1294     CDS       T04526                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:laq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    GLA29479_1294 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:laq03400]
    GLA29479_1294 (recD)
Enzymes [BR:laq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GLA29479_1294 (recD)
DNA repair and recombination proteins [BR:laq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GLA29479_1294 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase UvrD_C SH3_13 AAA_22 AAA_28 Herpes_Helicase Mg_chelatase T2SSE DEAD NTPase_1 HTH_15
Motif
Other DBs
NCBI-ProteinID: ALN62178
Position
complement(1381959..1383821)
Genome map
AA seq 620 aa AA seqDB search
MSLLDTLYREGALRTIDHALAQALRRLDRDTPDWVLAAAALASQAIAHGHAAFDPSRPWL
LSDAAIDWPPAEEWLAALRDSRWIAAPADGAVAHRDAPLVLERGLLYLRRYREYERRLAA
GLRRIAASAPPAPDLAALAPLFAALFPNARDDDRQARAAAVALLQSLLLATGGPGTGKTT
TIARLLVLLIAQARVEGAEPPRIALAAPTGRAAERMAESLRAAASRLRDLDGVETTLCEA
LPVEASTLHRLLGSVPDSPRFRHDASRPLPFDIVVVDEASMVDLPLMCKLVEAVADGARL
ILLGDRDQLPSVEAGDVLAAIVDAAGEDDGLPLALAERLRPLLGDALPVQPDPTPLGAYR
VHLRRGYRQAESLELAPLAEATRAGDADAVLALLRGGRLAGVQFHEDMYDPLSGNGRELL
LPTWRALAGAADPLEALALAARLRLLTALRDGGQGAAPLNARIEEALAGAHRPPYFHGRL
LLITENSYRHGLFNGDIGVCLRADAGARPAGAREQEGSAATTVAWFAGGSDGVRGFHPSA
LPAHGGAFAMTVHKAQGSEFDSVWLQLPRQDARHLSRELLYTGMTRARQSLHIAASEPVL
RQALSRHAARVSGLAWRLGG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgatacgctctatcgcgaaggcgccttgcgcacgatcgaccacgcgctg
gcccaggcgctgcgccggctcgaccgcgacacgcccgactgggtgctggcggcggcggcg
ctggcctcgcaggcgatcgcccacggccatgccgcgttcgatccgtcgcgaccgtggctg
ttgagcgatgcggcgatcgactggccgcctgcggaggaatggttggcggcgttgcgcgat
tcgcgctggatcgccgcgccggccgacggcgccgtcgctcatcgcgacgcgcccttggtg
ctggagcgcggcctgctgtatctgcgccgttatcgcgaatacgaacgccggctcgccgcc
ggcctgcgccggatcgccgcctcggcgccgccggcgccggacctggcggccctggcgccg
ttgttcgcggcgctgtttccgaacgcgcgcgacgacgaccggcaggcgcgcgccgcggca
gtggccttgttgcaatcgctgttgctcgccaccggcggccccggcaccggcaagaccacc
accatcgcgcggctgctggtgttgttgatcgcgcaggcccgcgtcgaaggcgcggagccg
ccgcggatcgcactggccgcgccgaccgggcgtgccgccgaacgcatggccgaaagcctg
cgtgcggcagcgtcgcggctgcgcgacctggacggcgtcgagacgacgttgtgcgaggct
ttgccggtcgaagcgagcaccctgcaccgcctgctcggcagcgtgcccgacagcccgcgc
ttccgtcacgacgccagccggccgctgccgttcgacatcgtggtggtcgacgaggcttcg
atggtcgacctgccgttgatgtgcaagctggtcgaggcggtggccgacggcgcacgcctg
atcctgctcggcgaccgcgatcaactgccttcggtcgaagccggcgacgtgctcgccgcg
atcgtcgatgccgccggcgaggacgacggcctgccgttggcgctcgcggagcggttgcgg
cctttgctcggcgatgccttgccggtacaacccgacccgaccccgctcggcgcctaccgg
gtgcatctgcgtcgtggctatcgccaggccgagagcctggaactggcaccgctggctgag
gccacccgcgccggcgatgccgatgcggtgctcgctttgttgcgcggtggccgcctggcc
ggcgtgcagttccacgaagacatgtacgacccgctcagcggcaacggccgcgaactgctg
ttgccgacctggcgtgccttggccggcgccgccgacccgctggaagcgctcgccctggcg
gcgcgcctgcgcctgctgaccgccttgcgcgacggcggccaaggcgcggcgccgttgaat
gcacgcatcgaagaagcgctcgcaggcgcgcatcgcccgccgtacttccatggccgcttg
ctgctgatcaccgagaacagctaccgccatggtttgttcaacggcgacatcggcgtctgc
ctgcgcgccgatgcgggcgctcgcccggccggtgcgcgcgaacaagagggtagtgcggcg
accacggtggcctggttcgccggcggcagcgacggcgtgcgcggtttccatccctcggcc
ctgcctgcgcacggcggcgccttcgcgatgaccgtgcacaaggcccagggctccgagttc
gacagcgtctggctgcagctgccgcgccaggacgcgcgtcatctctcacgcgagttgctc
tacaccggcatgacccgcgcgcggcaatcgttgcacatcgccgccagcgaaccggtgctg
aggcaggcgctgtcgcggcatgcggcgcgggtgtcggggttggcgtggcggttgggcggg
tga

DBGET integrated database retrieval system