KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_1924Help
Entry
GLA29479_1924     CDS       T04526                                 

Gene name
fbab
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00010  Glycolysis / Gluconeogenesis
laq00030  Pentose phosphate pathway
laq00051  Fructose and mannose metabolism
laq00680  Methane metabolism
laq01100  Metabolic pathways
laq01110  Biosynthesis of secondary metabolites
laq01120  Microbial metabolism in diverse environments
laq01130  Biosynthesis of antibiotics
laq01200  Carbon metabolism
laq01230  Biosynthesis of amino acids
Module
laq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLA29479_1924 (fbab)
   00030 Pentose phosphate pathway
    GLA29479_1924 (fbab)
   00051 Fructose and mannose metabolism
    GLA29479_1924 (fbab)
  09102 Energy metabolism
   00680 Methane metabolism
    GLA29479_1924 (fbab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:laq04131]
    GLA29479_1924 (fbab)
   03036 Chromosome and associated proteins [BR:laq03036]
    GLA29479_1924 (fbab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laq04147]
    GLA29479_1924 (fbab)
Enzymes [BR:laq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GLA29479_1924 (fbab)
Membrane trafficking [BR:laq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GLA29479_1924 (fbab)
Chromosome and associated proteins [BR:laq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GLA29479_1924 (fbab)
Exosome [BR:laq04147]
 Exosomal proteins
  Proteins found in most exosomes
   GLA29479_1924 (fbab)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-ProteinID: ALN62797
Position
complement(2108803..2109813)
Genome map
AA seq 336 aa AA seqDB search
MSIEQLAETAQAMVAAGKGIIAIDESNATIAKRFAGVGIDNTEENRRAYRELLLTTPKIG
DYISGAILYDETIRQSTKAGVPFTKIMMDNGVIPGIKVDKGPQPLAGFPGEVVTEGLDGL
RARLEEYYKLGARFAKWRAVINIGDDIPSGTCIEANSHALARYAALCQEQGLVPMVEPEV
IMDGSHDIDTCFEVTEVTLRSLFGALYEQSVVLEGTILKASMVLPGTLASDRASIDDVAA
ATLQCLKSTVPATLPGIVFLSGGQSDEDATAHLNAMNQMGPNPWPLSFSYGRAMQSAALK
LWSQDLVGNIAKAQQTVYERAKANGLAALGQWKSAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaacagcttgccgaaaccgcccaggccatggtcgccgcgggcaagggcatc
atcgcgatcgacgagtcgaacgccaccatcgccaagcgtttcgccggcgtcggtatcgac
aacaccgaagagaatcgccgcgcctaccgcgagctgctgctcaccacgccgaagatcggc
gactacatctccggcgccatcctgtacgacgaaaccatccgtcagtcgaccaaggccggc
gtgccgttcaccaagatcatgatggataacggcgtgatcccgggcatcaaggtcgacaag
ggcccgcagccgctggccggcttccccggcgaagtcgtgaccgaaggcctcgacggcctg
cgcgcgcgcctggaggagtactacaagctcggcgcccgcttcgccaagtggcgcgcggtc
atcaacatcggcgacgacatcccgtcgggcacctgcatcgaagccaacagccatgcgctg
gcgcgctatgccgcgctgtgccaggagcagggcctggtgccgatggtcgagccggaagtc
atcatggacggcagccacgacatcgacacctgcttcgaagtcaccgaagtgaccctgcgt
tcgctgttcggcgcgctgtacgagcagagcgtggtgctcgaaggcaccatcctgaaggcc
tcgatggtcctgccgggcaccctggccagcgaccgcgccagcatcgacgacgtcgccgcg
gccaccctgcagtgcctgaagtcgaccgtgccggcgaccctgccgggcatcgtgttcctg
tcgggcggccagtcggacgaggacgccaccgcgcacctcaacgcgatgaaccagatgggc
ccgaacccgtggccgctgtcgttctcgtacggccgcgccatgcagtcggcggcgctgaag
ctgtggtcgcaggacctggtcggcaacatcgccaaggcccagcagaccgtgtacgagcgc
gccaaggccaacggcctggcggcgctgggccagtggaagtcggcggcgtaa

DBGET integrated database retrieval system