KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_3838Help
Entry
GLA29479_3838     CDS       T04526                                 

Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00071  Fatty acid degradation
laq00072  Synthesis and degradation of ketone bodies
laq00280  Valine, leucine and isoleucine degradation
laq00310  Lysine degradation
laq00362  Benzoate degradation
laq00380  Tryptophan metabolism
laq00620  Pyruvate metabolism
laq00630  Glyoxylate and dicarboxylate metabolism
laq00640  Propanoate metabolism
laq00650  Butanoate metabolism
laq00900  Terpenoid backbone biosynthesis
laq01100  Metabolic pathways
laq01110  Biosynthesis of secondary metabolites
laq01120  Microbial metabolism in diverse environments
laq01130  Biosynthesis of antibiotics
laq01200  Carbon metabolism
laq01212  Fatty acid metabolism
laq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GLA29479_3838
   00630 Glyoxylate and dicarboxylate metabolism
    GLA29479_3838
   00640 Propanoate metabolism
    GLA29479_3838
   00650 Butanoate metabolism
    GLA29479_3838
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GLA29479_3838
   00072 Synthesis and degradation of ketone bodies
    GLA29479_3838
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GLA29479_3838
   00310 Lysine degradation
    GLA29479_3838
   00380 Tryptophan metabolism
    GLA29479_3838
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GLA29479_3838
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GLA29479_3838
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GLA29479_3838
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laq04147]
    GLA29479_3838
Enzymes [BR:laq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GLA29479_3838
Exosome [BR:laq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLA29479_3838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALN64689
Position
4175155..4176432
Genome map
AA seq 425 aa AA seqDB search
MRQNRPVAVLGGVRIPFCRQNTAYADVGNLGMSVRTLGALVEKFGLHGQQLGEVAMGAVI
KHSSDWNLGREAALSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIDVGIGGGSDT
TSDVPIVYGKSLRRRLLEAARGRSTKGKLAAFKGFSLRELKPEFPGVAEPRTGKSMGEHC
EDMAKQWNISRDSQDEWALSSHQKLAAAYERGFFEDLVVSFRGVSRDNNLRADSSLEKLA
TLKPAFDKTSGRGTLTAANSTPLTDGAAACLLASEEWAQAHNHEVLCYLRDAQVAAVDFV
HGEGLLMAPTVAVPEMLKRNGLTLQDFDLYEIHEAFAAQVLCTLRAWESEDYCKTRLGLD
APLGRIDPAKINPNGSSLAAGHPFAATGARVVATAAKELKQRGGGRCLISICTAGGMGVV
AILER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaaaccgtcccgtcgccgtgctcggtggcgtgcgtattccgttctgccgccag
aacaccgcctatgcggatgtcggcaacctcggcatgtcggtgcgcaccctcggcgcgttg
gtcgaaaagttcggcttgcacgggcaacagctcggcgaagtggcgatgggcgcggtcatc
aagcacagcagcgactggaacctcggtcgcgaggcggcgctgtcgtcggggctgtcgccg
ctgacccccggcatcaccctgcagcgcgcctgcggcacctcgctggactcgatcatcacc
gtcgccaacaagatcgccctggggcagatcgacgtcggcatcggcggcggttcggacacc
acctcggacgtgccgatcgtctatggcaagagcctgcgccggcgcctgctggaagccgcg
cgcggacgcagcaccaagggcaagctggccgcgttcaagggcttcagcctgcgcgaactc
aagcccgagttccccggcgtggccgagccgcgcaccggcaagagcatgggcgagcactgc
gaggacatggccaagcagtggaacatctcgcgcgattcgcaggacgaatgggcgctgtcc
tcgcaccagaagctcgccgccgcttacgagcgcggcttcttcgaagacctggtggtcagc
ttccgcggggtgtcgcgcgacaacaacctgcgcgccgacagcagcctggaaaagctcgcg
accctgaagccggcgttcgacaagacctccggccgcggcactctgaccgcagcgaattcc
accccgctgaccgacggcgcggcggcctgtctgctggcgtcggaagaatgggcgcaggcg
cataaccacgaagtgctgtgctacctgcgcgatgcgcaggtagcggcggtcgatttcgtc
catggcgagggcctgctgatggcgccgaccgtggccgtgccggagatgctcaagcgtaac
ggcctgaccttgcaggacttcgacctgtacgaaatccacgaggccttcgccgcccaggtg
ttgtgcaccctgcgcgcctgggagagcgaggactactgcaagacccgtctcggcctggac
gcgccgctgggccgcatcgacccggccaagatcaaccccaacggttcctcgctggcggcg
ggtcatccgtttgccgcgaccggcgcgcgcgtggtggccactgccgcgaaggaactcaaa
cagcgcggcggcggccgctgcctgatctcgatctgcaccgccggcggcatgggcgtggtg
gcgattctggagcgttga

DBGET integrated database retrieval system