KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_3854Help
Entry
GLA29479_3854     CDS       T04526                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor kinase PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:laq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GLA29479_3854 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:laq01001]
    GLA29479_3854 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:laq02022]
    GLA29479_3854 (phoR)
Enzymes [BR:laq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GLA29479_3854 (phoR)
Protein kinases [BR:laq01001]
 Histidine kinases
  OmpR family
   GLA29479_3854 (phoR)
Two-component system [BR:laq02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   GLA29479_3854 (phoR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PhoR HisKA PAS_8 PAS DUF3155
Motif
Other DBs
NCBI-ProteinID: ALN64705
UniProt: A0A0S2E1V3
Position
4192232..4193590
Genome map
AA seq 452 aa AA seqDB search
MPPRARSAWFRTLGQLALILVGAAVLGVLIGYPWPVVTFAALGVVAWHYWRLRRVLIRLT
ARQRLTPPLGEGIWNELDRLLHRSQAEMRGRKRRLIEMLRAYRAAAAAMPDAIVVVERNS
QRIQWFNEAATGLFGLRYPRDIGAPVVQRLQPLQLAHWLASGRNAEPLEAASPWNPAITL
SLRLIPYSENLWLLVARDVSRLLQLEQMRRDFVANVSHELRTPLTVVHGYLDLLDPEEHP
DWAPMLAEMQRQSQRMTQLVEDLLTLSRLESQDSLPAEEIVAMASMLSTLKREANALSQG
RHEIAMDDLAGVDLFGSNKELHSAFSNLVSNAIRYTPAGGTIRIRFRPESAGIARGAVLE
VVDSGYGIPAAHLPRITERFYRVSTSRSRESGGTGLGLSIVKHVLNLHQARLEIASEVGR
GSTFACHFGIDRIRRRDAYQDAFADTLPDVLP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctccccgcgcacgctccgcctggttccgcaccctcggtcagctcgccctgatcctg
gtcggcgccgccgtgctcggcgtgctgatcggctatccctggccggtggtcacgttcgcc
gcgctcggcgtcgtcgcctggcactactggcggctgcgccgagtgctgatccgcctgacc
gcgcgccagcgcctcaccccgccgctcggcgaaggcatctggaacgaactcgatcgcctg
ctgcaccgcagccaggccgagatgcgcgggcgcaagcgccgcctgatcgagatgctgcgc
gcctatcgcgccgccgccgcggccatgcccgacgccatcgtcgtggtcgaacgcaacagc
cagcgcatccagtggttcaacgaggccgccaccggcctgttcggcctgcgctacccgcgc
gacatcggcgcgccggtggtgcaacgcctgcagccgctgcaactggcgcactggctggcc
tcgggccgcaacgccgagccgctggaagcggcctcgccgtggaacccggcgatcaccctg
agcctgcgcctgatcccgtactcggaaaacctctggctgctggtcgcgcgcgacgtcagc
cgcctgctgcaactcgagcagatgcgccgcgacttcgtcgccaacgtctcgcacgaactg
cgcacgccgctgaccgtggtgcacggctatctggacctgctcgatccggaagaacacccg
gattgggcgccgatgctggcggaaatgcaacgccagtcgcagcgcatgactcagttggtc
gaagacctgctgaccctgtcgcggctggaatcgcaggacagcctgccggccgaggaaatc
gtcgcgatggcctcgatgctgtccacgctcaagcgcgaagccaatgcgctgagccagggt
cggcacgagatcgcgatggacgatctggccggggtcgacctgttcggctccaacaaggaa
ctgcacagcgcgttctccaacctggtcagcaacgcgatccgctacacccccgccggcggc
acgatccgcatccgcttccgcccggaaagcgccggcatcgcccgcggcgcggtgctcgaa
gtggtcgacagcggctacggcatcccggccgcgcacctgccgcgcatcaccgagcgtttc
taccgcgtttcgaccagccgctcgcgtgaaagcggcggcaccggcctgggcctgtcgatc
gtcaagcacgtgctgaacctgcaccaggcgcggctggagatcgccagcgaagtcggccgc
ggcagcaccttcgcctgtcacttcggcatcgaccggatccgccgccgcgacgcttaccaa
gatgcattcgccgatactctccccgacgtcctgccttag

DBGET integrated database retrieval system